ACBD3 (NM_022735) Human Tagged ORF Clone

CAT#: RC208434

Reviews ()
Write a review

ACBD3 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 3 (ACBD3)



  "NM_022735" in other vectors (4)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ACBD3 (NM_022735) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ACBD3
Synonyms GCP60; GOCAP1; GOLPH1; PAP7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC208434 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGTGCTGAACGCAGAGCGACTCGAGGTGTCCGTCGACGGCCTCACGCTCAGCCCGGACCCGG
AGGAGCGGCCTGGGGCGGAGGGCGCCCCGCTGCTGCCGCCACCGCTGCCACCGCCCTCGCCACCTGGATC
CGGTCGCGGCCCGGGCGCCTCAGGGGAGCAGCCCGAGCCCGGGGAGGCGGCGGCTGGGGGCGCGGCGGAG
GAGGCGCGGCGGCTGGAGCAGCGCTGGGGTTTCGGCCTGGAGGAGTTGTACGGCCTGGCACTGCGCTTCT
TCAAAGAAAAAGATGGCAAAGCATTTCATCCAACTTATGAAGAAAAATTGAAGCTTGTGGCACTGCATAA
GCAAGTTCTTATGGGCCCATATAATCCAGACACTTGTCCTGAGGTTGGATTCTTTGATGTGTTGGGGAAT
GACAGGAGGAGAGAATGGGCAGCCCTGGGAAACATGTCTAAAGAGGATGCCATGGTGGAGTTTGTCAAGC
TCTTAAATAGGTGTTGCCATCTCTTTTCAACATATGTTGCGTCCCACAAAATAGAGAAGGAAGAGCAAGA
AAAAAAAAGGAAGGAGGAAGAGGAGCGAAGGCGGCGTGAAGAGGAAGAAAGAGAACGTCTGCAAAAGGAG
GAAGAGAAACGTAGGAGAGAAGAAGAGGAAAGGCTTCGACGGGAGGAAGAGGAAAGGAGACGGATAGAAG
AAGAAAGGCTTCGGTTGGAGCAGCAAAAGCAGCAGATAATGGCAGCTTTAAACTCCCAGACTGCCGTGCA
GTTCCAGCAGTATGCAGCCCAACAGTATCCAGGGAACTACGAACAGCAGCAAATTCTCATCCGCCAGTTG
CAGGAGCAACACTATCAGCAGTACATGCAGCAGTTGTATCAAGTCCAGCTTGCACAGCAACAGGCAGCAT
TACAGAAACAACAGGAAGTAGTAGTGGCTGGGTCTTCCTTGCCTACATCATCAAAAGTGAATGCAACTGT
ACCAAGTAATATGATGTCAGTTAATGGACAGGCCAAAACACACACTGACAGCTCCGAAAAAGAACTGGAA
CCGGAAGCTGCAGAAGAAGCCCTGGAGAATGGACCAAAAGAATCTCTTCCAGTAATAGCAGCTCCATCCA
TGTGGACACGACCTCAGATCAAAGACTTCAAAGAGAAGATTCAGCAGGATGCAGATTCCGTGATTACAGT
GGGCCGAGGAGAAGTGGTCACTGTTCGAGTACCCACCCATGAAGAAGGATCATATCTCTTTTGGGAATTT
GCCACAGACAATTATGACATTGGGTTTGGGGTGTATTTTGAATGGACAGACTCTCCAAACACTGCTGTCA
GCGTGCATGTCAGTGAGTCCAGCGATGACGACGAGGAGGAAGAAGAAAACATCGGTTGTGAAGAGAAAGC
CAAAAAGAATGCCAACAAGCCTTTGCTGGATGAGATTGTGCCTGTGTACCGACGGGACTGTCATGAGGAG
GTGTATGCTGGCAGCCATCAATATCCAGGGAGAGGAGTCTATCTCCTCAAGTTTGACAACTCCTACTCTT
TGTGGCGGTCAAAATCAGTCTACTACAGAGTCTATTATACTAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208434 protein sequence
Red=Cloning site Green=Tags(s)

MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAE
EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGN
DRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKE
EEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL
QEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE
PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF
ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEE
VYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_022735
ORF Size 1584 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022735.2, NM_022735.3, NP_073572.2
RefSeq Size 3581 bp
RefSeq ORF 1587 bp
Locus ID 64746
Cytogenetics 1q42.12
Domains ACBP
Protein Families Druggable Genome
MW 60.6 kDa
Gene Summary The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq, Jul 2008]

Citations (2)

Other Versions

Other products for "ACBD3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ACBD3 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools