ACBD3 (NM_022735) Human Tagged ORF Clone

CAT#: RC208434

ACBD3 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 3 (ACBD3)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ACBD3 (NM_022735) Human Tagged ORF Clone
Symbol ACBD3
Synonyms GCP60; GOCAP1; GOLPH1; PAP7
Vector pCMV6-Entry
Sequence Data
>RC208434 representing NM_022735
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGTGCTGAACGCAGAGCGACTCGAGGTGTCCGTCGACGGCCTCACGCTCAGCCCGGACCCGG
AGGAGCGGCCTGGGGCGGAGGGCGCCCCGCTGCTGCCGCCACCGCTGCCACCGCCCTCGCCACCTGGATC
CGGTCGCGGCCCGGGCGCCTCAGGGGAGCAGCCCGAGCCCGGGGAGGCGGCGGCTGGGGGCGCGGCGGAG
GAGGCGCGGCGGCTGGAGCAGCGCTGGGGTTTCGGCCTGGAGGAGTTGTACGGCCTGGCACTGCGCTTCT
TCAAAGAAAAAGATGGCAAAGCATTTCATCCAACTTATGAAGAAAAATTGAAGCTTGTGGCACTGCATAA
GCAAGTTCTTATGGGCCCATATAATCCAGACACTTGTCCTGAGGTTGGATTCTTTGATGTGTTGGGGAAT
GACAGGAGGAGAGAATGGGCAGCCCTGGGAAACATGTCTAAAGAGGATGCCATGGTGGAGTTTGTCAAGC
TCTTAAATAGGTGTTGCCATCTCTTTTCAACATATGTTGCGTCCCACAAAATAGAGAAGGAAGAGCAAGA
AAAAAAAAGGAAGGAGGAAGAGGAGCGAAGGCGGCGTGAAGAGGAAGAAAGAGAACGTCTGCAAAAGGAG
GAAGAGAAACGTAGGAGAGAAGAAGAGGAAAGGCTTCGACGGGAGGAAGAGGAAAGGAGACGGATAGAAG
AAGAAAGGCTTCGGTTGGAGCAGCAAAAGCAGCAGATAATGGCAGCTTTAAACTCCCAGACTGCCGTGCA
GTTCCAGCAGTATGCAGCCCAACAGTATCCAGGGAACTACGAACAGCAGCAAATTCTCATCCGCCAGTTG
CAGGAGCAACACTATCAGCAGTACATGCAGCAGTTGTATCAAGTCCAGCTTGCACAGCAACAGGCAGCAT
TACAGAAACAACAGGAAGTAGTAGTGGCTGGGTCTTCCTTGCCTACATCATCAAAAGTGAATGCAACTGT
ACCAAGTAATATGATGTCAGTTAATGGACAGGCCAAAACACACACTGACAGCTCCGAAAAAGAACTGGAA
CCGGAAGCTGCAGAAGAAGCCCTGGAGAATGGACCAAAAGAATCTCTTCCAGTAATAGCAGCTCCATCCA
TGTGGACACGACCTCAGATCAAAGACTTCAAAGAGAAGATTCAGCAGGATGCAGATTCCGTGATTACAGT
GGGCCGAGGAGAAGTGGTCACTGTTCGAGTACCCACCCATGAAGAAGGATCATATCTCTTTTGGGAATTT
GCCACAGACAATTATGACATTGGGTTTGGGGTGTATTTTGAATGGACAGACTCTCCAAACACTGCTGTCA
GCGTGCATGTCAGTGAGTCCAGCGATGACGACGAGGAGGAAGAAGAAAACATCGGTTGTGAAGAGAAAGC
CAAAAAGAATGCCAACAAGCCTTTGCTGGATGAGATTGTGCCTGTGTACCGACGGGACTGTCATGAGGAG
GTGTATGCTGGCAGCCATCAATATCCAGGGAGAGGAGTCTATCTCCTCAAGTTTGACAACTCCTACTCTT
TGTGGCGGTCAAAATCAGTCTACTACAGAGTCTATTATACTAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208434 representing NM_022735
Red=Cloning site Green=Tags(s)

MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAE
EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGN
DRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKE
EEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL
QEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE
PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF
ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEE
VYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_022735
ORF Size 1584 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022735.2, NM_022735.3, NP_073572
RefSeq Size 3581
RefSeq ORF 1587
Locus ID 64746
Cytogenetics 1q42.12
Domains ACBP
Protein Families Druggable Genome
MW 60.4 kDa
Gene Summary The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)