NR1D2 (NM_005126) Human Tagged ORF Clone

CAT#: RC206338

Reviews ()
Write a review

NR1D2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1



Reconstitution Protocol

USD 808.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NR1D2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NR1D2
Synonyms BD73; EAR-1R; REVERBB; REVERBbeta; RVR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206338 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGAATGCAGGAGGTGTGATTGCCTATATCAGTTCTTCCAGCTCAGCCTCAAGCCATGCCTCTT
GTCACAGTGAGGGTTCTGAGAATAGTTTCCAGTCCTCCTCCTCTTCTGTTCCATCTTCTCCAAATAGCTC
TAATTCTGATACCAATGGTAATCCCAAGAATGGTGATCTCGCCAATATTGAAGGCATCTTGAAGAATGAT
CGAATAGATTGTTCTATGAAAACAAGCAAATCGAGTGCACCTGGGATGACAAAAAGTCATAGTGGTGTGA
CAAAATTTAGTGGCATGGTTCTACTGTGTAAAGTCTGTGGGGATGTGGCGTCAGGATTCCACTATGGAGT
TCATGCTTGCGAAGGCTGTAAGGGTTTCTTTCGGAGAAGTATTCAACAAAACATCCAGTACAAGAAGTGC
CTGAAGAATGAAAACTGTTCTATAATGAGAATGAATAGGAACAGATGTCAGCAATGTCGCTTCAAAAAGT
GTCTGTCTGTTGGAATGTCAAGAGATGCTGTTCGGTTTGGTCGTATTCCTAAGCGTGAAAAACAGAGGAT
GCTAATTGAAATGCAAAGTGCAATGAAGACCATGATGAACAGCCAGTTCAGTGGTCACTTGCAAAATGAC
ACATTAGTAGAACATCATGAACAGACAGCCTTGCCAGCCCAGGAACAGCTGCGACCCAAGCCCCAACTGG
AGCAAGAAAACATCAAAAGCTCTTCTCCTCCATCTTCTGATTTTGCAAAGGAAGAAGTGATTGGCATGGT
GACCAGAGCTCACAAGGATACCTTTATGTATAATCAAGAGCAGCAAGAAAACTCAGCTGAGAGCATGCAG
CCCAAGAGAGGAGAACGGATTCGCAAGAACATGGAGCAATATAATTTAAATCATGATCATTGCGGCAATG
GGCTTAGCAGCCATTTTCCCTGTAGTGAGAGCCAGCAGCATCTCAATGGACAGTTCAAAGGGAGGAATAT
AATGCATTACCCAAATGGTCATGCCATTTGTATTGCAAATGGACATTGTATGAACTTCTCCAATGCTTAT
ACTCAAAGAGTATGTGATAGAGTTCCGATAGATGGATTTTCTCAGAATGAGAACAAGAATAGTTACCTGT
GCAACACTGGAGGAAGAATGCATCTGGTTTGTCCAATGAGTAAGTCTCCATATGTGGATCCTCATAAATC
AGGACATGAAATCTGGGAAGAATTTTCGATGAGCTTCACTCCAGCAGTGAAAGAAGTGGTGGAATTTGCA
AAGCGTATTCCTGGGTTCAGAGATCTCTCTCAGCATGACCAGGTCAACCTTTTAAAGGCTGGGACTTTTG
AGGTTTTAATGGTACGGTTCGCATCATTATTTGATGCAAAGGAACGTACTGTCACCTTTTTAAGTGGAAA
GAAATATAGTGTGGATGATTTACACTCAATGGGAGCAGGGGATCTGCTAAACTCTATGTTTGAATTTAGT
GAGAAGCTAAATGCCCTCCAACTTAGTGATGAAGAGATGAGTTTGTTTACAGCTGTTGTCCTGGTATCTG
CAGATCGATCTGGAATAGAAAACGTCAACTCTGTGGAGGCTTTGCAGGAAACTCTCATTCGTGCACTAAG
GACCTTAATAATGAAAAACCATCCAAATGAGGCCTCTATTTTTACAAAACTGCTTCTAAAGTTGCCAGAT
CTTCGATCTTTAAACAACATGCACTCTGAGGAGCTCTTGGCCTTTAAAGTTCACCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206338 protein sequence
Red=Cloning site Green=Tags(s)

MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKND
RIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKC
LKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQND
TLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQ
PKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY
TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFS
EKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD
LRSLNNMHSEELLAFKVHP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005126
ORF Size 1737 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005126.3
RefSeq Size 5268 bp
RefSeq ORF 1740 bp
Locus ID 9975
UniProt ID Q14995
Cytogenetics 3p24.2
Domains HOLI, zf-C4
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
MW 64.7 kDa
Gene Summary This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.