Prolactin (PRL) (NM_000948) Human Tagged ORF Clone

CAT#: RC205627

PRL (Myc-DDK-tagged)-Human prolactin (PRL), transcript variant 1

Product Images

Circular map for RC205627

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY PRL (Cat# RC205627, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PRL(Cat# TA500719). Positive lysates LY424443 (100ug) and LC424443 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY431796) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC228768 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified PRL protein (Cat# TP305627). The protein was produced from HEK293T cells transfected with PRL cDNA clone (Cat# RC205627) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Prolactin
• Synonyms: GHA1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205627 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAACATCAAAGGATCGCCATGGAAAGGGTCCCTCCTGCTGCTGCTGGTGTCAAACCTGCTCCTGTGCC
  AGAGCGTGGCCCCCTTGCCCATCTGTCCCGGCGGGGCTGCCCGATGCCAGGTGACCCTTCGAGACCTGTT
  TGACCGCGCCGTCGTCCTGTCCCACTACATCCATAACCTCTCCTCAGAAATGTTCAGCGAATTCGATAAA
  CGGTATACCCATGGCCGGGGGTTCATTACCAAGGCCATCAACAGCTGCCACACTTCTTCCCTTGCCACCC
  CCGAAGACAAGGAGCAAGCCCAACAGATGAATCAAAAAGACTTTCTGAGCCTGATAGTCAGCATATTGCG
  ATCCTGGAATGAGCCTCTGTATCATCTGGTCACGGAAGTACGTGGTATGCAAGAAGCCCCGGAGGCTATC
  CTATCCAAAGCTGTAGAGATTGAGGAGCAAACCAAACGGCTTCTAGAGGGCATGGAGCTGATAGTCAGCC
  AGGTTCATCCTGAAACCAAAGAAAATGAGATCTACCCTGTCTGGTCGGGACTTCCATCCCTGCAGATGGC
  TGATGAAGAGTCTCGCCTTTCTGCTTATTATAACCTGCTCCACTGCCTACGCAGGGATTCACATAAAATC
  GACAATTATCTCAAGCTCCTGAAGTGCCGAATCATCCACAACAACAACTGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205627 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDK
  RYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAI
  LSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKI
  DNYLKLLKCRIIHNNNC
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_000948
• ORF Size: 681 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000948.6
• RefSeq Size: 1371 bp
• RefSeq ORF: 684 bp
• Locus ID: 5617
• UniProt ID: P01236
• Cytogenetics: 6p22.3
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction
• MW: 25.9 kDa
• Gene Summary: This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011]