RASA1 (NM_002890) Human Tagged ORF Clone

CAT#: RC205473

Reviews ()
Write a review

RASA1 (Myc-DDK-tagged)-Human RAS p21 protein activator (GTPase activating protein) 1 (RASA1), transcript variant 1



Reconstitution Protocol

USD 911.00

USD 1,367.00

In Stock*

Size
    • 10 ug

Product images

Other products for "RASA1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RASA1
Synonyms CM-AVM; CMAVM; CMAVM1; GAP; p120; p120GAP; p120RASGAP; PKWS; RASA; RASGAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205473 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGCGGCCGAGGCCGGCAGTGAGGAGGGCGGCCCGGTAACAGCCGGAGCTGGAGGAGGCGGCGCGG
CAGCGGGCTCCAGTGCCTATCCCGCAGTGTGTCGGGTGAAGATACCCGCGGCCCTGCCTGTGGCAGCCGC
CCCCTATCCTGGGCTGGTGGAGACCGGAGTGGCTGGAACTCTGGGTGGCGGAGCCGCTTTGGGGTCAGAG
TTCCTAGGAGCCGGGTCTGTGGCAGGGGCACTGGGGGGAGCTGGACTGACAGGGGGAGGTACTGCTGCTG
GCGTAGCTGGTGCTGCTGCTGGCGTGGCCGGTGCTGCTGTTGCTGGACCTAGTGGAGACATGGCTCTCAC
CAAACTGCCCACTTCGTTGCTTGCTGAGACTCTCGGGCCAGGCGGCGGTTTTCCCCCTCTGCCCCCTCCC
CCTTACCTGCCCCCTTTGGGGGCGGGCCTCGGGACAGTGGACGAAGGTGACTCTCTGGATGGACCAGAAT
ACGAGGAGGAAGAGGTGGCCATACCGTTGACCGCTCCTCCAACTAACCAGTGGTATCACGGAAAACTTGA
CAGAACGATAGCAGAAGAACGCCTCAGGCAGGCAGGGAAGTCTGGCAGTTATCTTATAAGAGAGAGTGAT
CGGAGGCCAGGGTCCTTTGTACTTTCATTTCTTAGCCAGATGAATGTTGTCAACCATTTTAGGATTATTG
CTATGTGTGGAGATTACTACATTGGTGGAAGACGTTTTTCTTCACTGTCAGACCTAATAGGTTATTACAG
TCATGTTTCTTGTTTGCTTAAAGGAGAAAAATTACTTTACCCAGTTGCACCACCAGAGCCAGTAGAAGAT
AGAAGGCGTGTACGAGCTATTCTACCTTACACAAAAGTACCAGACACTGATGAAATAAGTTTCTTAAAAG
GAGATATGTTCATTGTTCATAATGAATTAGAAGATGGATGGATGTGGGTTACAAATTTAAGAACAGATGA
ACAAGGCCTTATTGTTGAAGACCTAGTAGAAGAGGTGGGCCGGGAAGAAGATCCACATGAAGGAAAAATA
TGGTTCCATGGGAAGATTTCCAAACAGGAAGCTTATAATTTACTAATGACAGTTGGTCAAGTCTGCAGTT
TTCTTGTGAGGCCCTCAGATAATACTCCTGGCGATTATTCACTTTATTTCCGGACCAATGAAAATATTCA
GCGATTTAAAATATGTCCAACGCCAAACAATCAGTTTATGATGGGAGGCCGGTATTATAACAGCATTGGG
GACATCATAGATCACTATCGAAAAGAACAGATTGTTGAAGGATATTATCTTAAGGAACCTGTACCAATGC
AGGATCAAGAACAAGTACTCAATGACACAGTGGATGGCAAGGAAATCTATAATACCATCCGTCGTAAAAC
AAAGGATGCCTTTTATAAAAACATTGTTAAGAAAGGTTATCTTCTGAAAAAGGGCAAAGGAAAACGTTGG
AAAAATTTATATTTTATCTTAGAGGGTAGTGATGCCCAACTTATTTATTTTGAAAGCGAAAAACGAGCTA
CCAAACCAAAAGGATTAATAGATCTCAGTGTATGTTCTGTCTATGTCGTTCATGATAGTCTCTTTGGCAG
GCCAAACTGTTTTCAGATAGTAGTTCAGCACTTTAGTGAAGAACATTACATCTTTTACTTTGCAGGAGAA
ACTCCAGAACAAGCAGAGGATTGGATGAAAGGTCTGCAGGCATTTTGCAATTTACGGAAAAGTAGTCCAG
GGACATCCAATAAACGCCTTCGTCAGGTCAGCAGCCTTGTTTTACATATTGAAGAAGCCCATAAACTCCC
AGTAAAACATTTTACTAATCCATATTGTAACATCTACCTGAATAGTGTCCAAGTAGCAAAAACTCATGCA
AGGGAAGGGCAAAACCCAGTATGGTCAGAAGAGTTTGTCTTTGATGATCTTCCTCCTGACATCAATAGAT
TTGAAATAACTCTTAGTAATAAAACAAAGAAAAGCAAAGATCCTGATATCTTATTTATGCGCTGCCAGTT
GAGCCGATTACAGAAAGGGCATGCCACAGATGAATGGTTTCTGCTCAGCTCCCATATACCATTAAAAGGT
ATTGAACCAGGGTCCCTGCGTGTTCGAGCACGATACTCTATGGAAAAAATCATGCCAGAAGAAGAGTACA
GTGAATTTAAAGAGCTTATACTGCAAAAGGAACTTCATGTAGTCTATGCTTTATCACATGTATGTGGACA
AGACCGAACACTACTGGCCAGCATCCTACTGAGGATTTTTCTTCACGAAAAGCTTGAATCGTTGTTGTTA
TGCACACTAAATGACAGAGAAATAAGCATGGAAGATGAAGCCACTACCCTATTTCGAGCCACAACACTTG
CAAGCACCTTGATGGAGCAGTATATGAAAGCCACTGCTACACAGTTTGTTCATCATGCTTTGAAAGACTC
TATTTTAAAGATAATGGAAAGCAAGCAGTCTTGTGAGTTAAGTCCATCAAAGTTAGAAAAAAATGAAGAT
GTGAACACTAATTTAACACACCTATTGAACATACTTTCAGAGCTTGTGGAGAAAATATTCATGGCTTCAG
AAATACTTCCACCGACATTGAGATATATTTATGGGTGTTTACAGAAATCTGTTCAGCATAAGTGGCCTAC
AAATACCACCATGAGAACAAGAGTTGTTAGTGGTTTTGTTTTTCTTCGACTCATCTGTCCTGCCATCCTG
AATCCACGGATGTTCAATATCATCTCAGATTCTCCATCTCCTATTGCTGCAAGAACACTGATATTAGTGG
CTAAATCTGTGCAGAACTTAGCAAATCTTGTGGAATTTGGAGCTAAGGAGCCCTACATGGAAGGTGTCAA
TCCATTCATCAAAAGCAACAAACATCGTATGATCATGTTTTTAGATGAACTTGGGAATGTACCTGAACTT
CCGGACACTACAGAGCATTCTAGAACGGACCTGTCCCGTGATTTAGCAGCATTGCATGAGATTTGCGTGG
CTCATTCAGATGAACTTCGAACGCTCAGTAATGAGCGTGGTGCACAGCAGCACGTATTGAAAAAGCTTCT
GGCTATAACAGAACTGCTTCAACAAAAACAAAACCAGTATACAAAAACCAATGATGTCAGG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC205473 protein sequence
Red=Cloning site Green=Tags(s)

MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTLGGGAALGSE
FLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLPTSLLAETLGPGGGFPPLPPP
PYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESD
RRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVED
RRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKI
WFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKRW
KNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGE
TPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHA
REGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKG
IEPGSLRVRARYSMEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLL
CTLNDREISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICPAIL
NPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNVPEL
PDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002890
ORF Size 3141 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002890.3
RefSeq Size 4402 bp
RefSeq ORF 3144 bp
Locus ID 5921
UniProt ID P20936
Cytogenetics 5q14.3
Domains C2, SH2, SH3, PH, RasGAP
Protein Families Druggable Genome
Protein Pathways Axon guidance, MAPK signaling pathway
MW 116.4 kDa
Gene Summary The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Mutations also have been associated with hereditary capillary malformations (CM) with or without arteriovenous malformations (AVM) and Parkes Weber syndrome. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues. [provided by RefSeq, May 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.