ID2 (NM_002166) Human Tagged ORF Clone
ID2 (Myc-DDK-tagged)-Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2)
"NM_002166" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ID2 |
Synonyms | bHLHb26; GIG8; ID2A; ID2H |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205324 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAAGCCTTCAGTCCCGTGAGGTCCGTTAGGAAAAACAGCCTGTCGGACCACAGCCTGGGCATCTCCC GGAGCAAAACCCCTGTGGACGACCCGATGAGCCTGCTATACAACATGAACGACTGCTACTCCAAGCTCAA GGAGCTGGTGCCCAGCATCCCCCAGAACAAGAAGGTGAGCAAGATGGAAATCCTGCAGCACGTCATCGAC TACATCTTGGACCTGCAGATCGCCCTGGACTCGCATCCCACTATTGTCAGCCTGCATCACCAGAGACCCG GGCAGAACCAGGCGTCCAGGACGCCGCTGACCACCCTCAACACGGATATCAGCATCCTGTCCTTGCAGGC TTCTGAATTCCCTTCTGAGTTAATGTCAAATGACAGCAAAGCACTGTGTGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205324 protein sequence
Red=Cloning site Green=Tags(s) MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002166 |
ORF Size | 402 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002166.5 |
RefSeq Size | 1402 bp |
RefSeq ORF | 405 bp |
Locus ID | 3398 |
UniProt ID | Q02363 |
Cytogenetics | 2p25.1 |
Domains | HLH |
Protein Families | ES Cell Differentiation/IPS, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
MW | 14.9 kDa |
Gene Summary | The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205324L1 | Lenti ORF clone of Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), Myc-DDK-tagged |
USD 525.00 |
|
RC205324L2 | Lenti ORF clone of Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), mGFP tagged |
USD 525.00 |
|
RC205324L3 | Lenti ORF clone of Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), Myc-DDK-tagged |
USD 525.00 |
|
RC205324L4 | Lenti ORF clone of Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), mGFP tagged |
USD 525.00 |
|
RG205324 | ID2 (tGFP-tagged) - Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2) |
USD 425.00 |
|
SC118791 | ID2 (untagged)-Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2) |
USD 225.00 |