GABA A Receptor beta 1(GABRB1) (NM_000812) Human Tagged ORF Clone

CAT#: RC205166

GABRB1 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, beta 1 (GABRB1)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GABA A Receptor beta 1(GABRB1) (NM_000812) Human Tagged ORF Clone
Symbol GABRB1
Synonyms gamma-aminobutyric acid (GABA) A receptor, beta 1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205166 representing NM_000812
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGACAGTACAAAATCGAGAGAGTCTGGGGCTTCTCTCTTTCCCTGTGATGATTACCATGGTCTGTT
GTGCACACAGCACCAATGAACCCAGCAACATGTCATACGTGAAAGAGACAGTGGACAGATTGCTCAAAGG
ATATGACATTCGCTTGCGGCCGGACTTCGGAGGGCCCCCCGTCGACGTTGGGATGCGGATCGATGTCGCC
AGCATAGACATGGTCTCCGAAGTGAATATGGATTATACACTCACCATGTATTTCCAGCAGTCTTGGAAAG
ACAAAAGGCTTTCTTATTCTGGAATCCCACTGAACCTCACCCTAGACAATAGGGTAGCTGACCAACTCTG
TGTACCAGACACCTACTTTCTGAATGACAAGAAATCATTTGTGCATGGGGTCACAGTGAAAAATCGAATG
ATTCGACTGCATCCTGATGGAACAGTTCTCTATGGACTCCGAATCACAACCACAGCTGCATGTATGATGG
ATCTTCGAAGATATCCACTGGATGAGCAGAACTGCACCCTGGAGATCGAAAGTTATGGCTATACCACTGA
TGACATTGAATTTTACTGGAATGGAGGAGAAGGGGCAGTCACTGGTGTTAATAAAATCGAACTTCCTCAA
TTTTCAATTGTTGACTACAAGATGGTGTCTAAGAAGGTGGAGTTCACAACAGGAGCGTATCCACGACTGT
CACTAAGTTTTCGTCTAAAGAGAAACATTGGTTACTTCATTTTGCAAACCTACATGCCTTCTACACTGAT
TACAATTCTGTCCTGGGTGTCTTTTTGGATCAACTATGATGCATCTGCAGCCAGAGTCGCACTAGGAATC
ACGACGGTGCTTACAATGACAACCATCAGCACCCACCTCAGGGAGACCCTGCCAAAGATCCCTTATGTCA
AAGCGATTGATATTTATCTGATGGGTTGCTTTGTGTTTGTGTTCCTGGCTCTGCTGGAGTATGCCTTTGT
AAATTACATCTTCTTTGGGAAAGGCCCTCAGAAAAAGGGAGCTAGCAAACAAGACCAGAGTGCCAATGAG
AAGAATAAACTGGAGATGAATAAAGTCCAGGTCGACGCCCACGGTAACATTCTCCTCAGCACCCTGGAAA
TCCGGAATGAGACGAGTGGCTCGGAAGTGCTCACGAGCGTGAGCGACCCCAAGGCCACCATGTACTCCTA
TGACAGCGCCAGCATCCAGTACCGCAAGCCCCTGAGCAGCCGCGAGGCCTACGGGCGCGCCCTGGACCGG
CACGGGGTACCCAGCAAGGGGCGCAACCGCAGGCGTGCCTCCCAGCTCAAAGTCAAGATCCCCGACTTGA
CTGATGTGAATTCCATAGACAAGTGGTCCCGAATGTTTTTCCCCATCACCTTTTCTCTTTTTAATGTCGT
CTATTGGCTTTACTATGTACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205166 representing NM_000812
Red=Cloning site Green=Tags(s)

MWTVQNRESLGLLSFPVMITMVCCAHSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVA
SIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLCVPDTYFLNDKKSFVHGVTVKNRM
IRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQ
FSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGI
TTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANE
KNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDR
HGVPSKGRNRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000812
ORF Size 1422 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000812.1, NM_000812.2, NM_000812.3, NP_000803
RefSeq Size 1925
RefSeq ORF 1425
Locus ID 2560
Cytogenetics 4p12
Domains Neur_chan_memb, Neur_chan_LBD
Protein Families Ion Channels: Cys-loop Receptors, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 54.1 kDa
Gene Summary The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)