GBE1 (NM_000158) Human Tagged ORF Clone

CAT#: RC204152

Reviews ()
Write a review

GBE1 (Myc-DDK-tagged)-Human glucan (1,4-alpha-), branching enzyme 1 (GBE1)



  "NM_000158" in other vectors (5)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GBE1
Synonyms APBD; GBE; GSD4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204152 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTCCGATGACTCCCGCGGCTCGGCCCGAGGACTACGAGGCGGCGCTCAATGCCGCCCTGGCTG
ACGTGCCCGAACTGGCCAGACTCCTGGAGATCGACCCGTACTTGAAGCCCTACGCCGTGGACTTCCAGCG
CAGGTATAAGCAGTTTAGCCAAATTTTGAAGAACATTGGAGAAAATGAAGGTGGTATTGATAAGTTTTCC
AGAGGCTATGAATCATTTGGCGTCCACAGATGTGCTGATGGTGGTTTATACTGCAAAGAATGGGCCCCGG
GAGCAGAAGGAGTTTTTCTTACTGGAGATTTTAATGGTTGGAATCCATTTTCGTACCCATACAAAAAACT
GGATTATGGAAAATGGGAGCTGTATATCCCACCAAAGCAGAATAAATCTGTACTCGTGCCTCATGGATCC
AAATTAAAGGTAGTTATTACTAGTAAAAGCGGAGAGATCTTGTATCGTATTTCACCGTGGGCAAAGTATG
TGGTTCGTGAAGGTGATAATGTGAATTATGATTGGATACACTGGGATCCAGAACACTCATATGAGTTTAA
GCATTCCAGACCAAAGAAGCCACGGAGTCTAAGAATTTATGAATCTCATGTGGGAATTTCTTCCCATGAA
GGAAAAGTAGCTTCTTATAAACATTTTACATGCAATGTACTACCAAGAATCAAAGGCCTTGGATACAACT
GCATTCAGTTGATGGCAATCATGGAGCATGCTTACTATGCCAGCTTTGGTTACCAAATCACAAGCTTCTT
TGCAGCTTCCAGCCGTTATGGATCACCTGAAGAGCTACAAGAACTGGTAGACACAGCTCATTCCATGGGT
ATCATAGTCCTCTTAGATGTGGTACACAGCCATGCTTCAAAAAATTCAGCAGATGGATTGAATATGTTTG
ATGGGACAGATTCCTGTTATTTTCATTCTGGACCTAGAGGGACTCATGATCTTTGGGATAGCAGATTGTT
TGCCTACTCCAGCTGGGAAGTTTTAAGATTCCTTCTGTCAAACATAAGATGGTGGTTGGAAGAATATCGC
TTTGATGGATTTCGTTTTGATGGTGTTACGTCCATGCTTTATCATCACCATGGAGTGGGTCAAGGTTTCT
CAGGTGATTACAGTGAATATTTCGGACTACAAGTAGATGAAGATGCCTTGACTTACCTCATGTTGGCAAA
TCATTTGGTTCACACGCTGTGTCCCGATTCTATAACAATAGCTGAGGATGTATCAGGAATGCCAGCTCTG
TGCTCTCCAATTTCCCAGGGAGGGGGTGGTTTTGACTATCGACTAGCCATGGCAATTCCAGATAAGTGGA
TTCAGCTACTTAAAGAGTTTAAAGATGAAGACTGGAACATGGGCGATATAGTATACACGCTCACAAACAG
GCGCTACCTTGAAAAGTGCATTGCTTATGCAGAGAGCCATGATCAGGCATTGGTTGGGGATAAGTCGCTG
GCATTTTGGTTGATGGATGCCGAAATGTATACAAACATGAGTGTCCTGACTCCTTTTACTCCAGTTATTG
ATCGTGGAATACAGCTTCATAAAATGATTCGACTCATTACGCATGGGCTTGGTGGAGAAGGCTATCTCAA
TTTCATGGGTAATGAATTTGGGCATCCTGAATGGTTAGACTTCCCAAGAAAAGGAAATAATGAGAGTTAC
CATTATGCCAGGCGGCAGTTTCATTTAACTGACGACGACCTTCTTCGCTACAAGTTCCTAAATAATTTTG
ACAGGGATATGAATAGATTGGAAGAAAGATATGGTTGGCTTGCAGCTCCACAGGCCTACGTGAGTGAAAA
ACATGAAGGCAATAAGATCATTGCTTTTGAAAGAGCAGGTCTTCTTTTCATTTTCAACTTCCATCCAAGC
AAGAGCTACACTGACTACCGAGTTGGAACAGCATTGCCAGGGAAATTCAAAATTGTGCTAGATTCAGATG
CAGCGGAATATGGAGGGCATCAGAGACTGGACCACAGCACTGACTTTTTTTCTGAGGCTTTTGAACATAA
TGGGCGTCCCTATTCTCTTTTGGTGTACATTCCAAGCAGAGTGGCCCTCATCCTTCAGAATGTGGATCTG
CCGAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204152 protein sequence
Red=Cloning site Green=Tags(s)

MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFS
RGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGS
KLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHE
GKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMG
IIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYR
FDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPAL
CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSL
AFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESY
HYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPS
KSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDL
PN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000158
ORF Size 2106 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000158.4
RefSeq Size 3118 bp
RefSeq ORF 2109 bp
Locus ID 2632
UniProt ID Q04446
Cytogenetics 3p12.2
Domains isoamylase_N, alpha-amylase, Aamy
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Starch and sucrose metabolism
MW 80.4 kDa
Gene Summary The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersen's disease). [provided by RefSeq, Jul 2008]

Other Versions

Other products for "GBE1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


GBE1 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.