Major Basic Protein (PRG2) (NM_002728) Human Tagged ORF Clone

CAT#: RC203256

PRG2 (Myc-DDK-tagged)-Human proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) (PRG2)

Product Images

Western blot validation of overexpression lysate (Cat# LY400961) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203256 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY PRG2 (Cat# RC203256, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PRG2 (Cat# TA813062)(1:500).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PRG2
• Synonyms: BMPG; MBP; MBP1; proMBP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203256 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAACTCCCCCTACTTCTGGCTCTTCTATTTGGGGCAGTTTCTGCTCTTCATCTAAGGTCTGAGACTT
  CCACCTTTGAGACCCCTTTGGGTGCTAAGACGCTGCCTGAGGATGAGGAGACACCAGAGCAGGAGATGGA
  GGAGACCCCTTGCAGGGAGCTGGAGGAAGAGGAGGAGTGGGGCTCTGGAAGTGAAGATGCCTCCAAGAAA
  GATGGGGCTGTTGAGTCTATCTCAGTGCCAGATATGGTGGACAAAAACCTTACGTGTCCTGAGGAAGAGG
  ACACAGTAAAAGTGGTGGGCATCCCTGGGTGCCAGACCTGCCGCTACCTCCTGGTGAGAAGTCTTCAGAC
  GTTTAGTCAAGCTTGGTTTACTTGCCGGAGGTGCTACAGGGGCAACCTGGTTTCCATCCACAACTTCAAT
  ATTAATTATCGAATCCAGTGTTCTGTCAGCGCGCTCAACCAGGGTCAAGTCTGGATTGGAGGCAGGATCA
  CAGGCTCGGGTCGCTGCAGACGCTTTCAGTGGGTTGACGGCAGCCGCTGGAACTTTGCGTACTGGGCTGC
  TCACCAGCCCTGGTCCCGCGGTGGTCACTGCGTGGCCCTGTGTACCCGAGGAGGCTACTGGCGTCGAGCC
  CACTGCCTCAGAAGACTTCCTTTCATCTGTTCCTAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203256 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKK
  DGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN
  INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRA
  HCLRRLPFICSY
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_002728
• ORF Size: 666 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_002728.6
• RefSeq Size: 874 bp
• RefSeq ORF: 669 bp
• Locus ID: 5553
• UniProt ID: P13727
• Cytogenetics: 11q12.1
• Domains: CLECT
• Protein Families: Secreted Protein
• Protein Pathways: Asthma
• MW: 25.2 kDa
• Gene Summary: The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions. The encoded protein contains a peptide that displays potent antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria, and fungi. It is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]