DRP1(DNM1L) (NM_012063) Human Tagged ORF Clone

CAT#: RC202046

DNM1L (Myc-DDK-tagged)-Human dynamin 1-like (DNM1L), transcript variant 2

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DRP1(DNM1L) (NM_012063) Human Tagged ORF Clone
Symbol DNM1L
Synonyms DLP1; DRP1; DVLP; DYMPLE; EMPF; EMPF1; HDYNIV
Vector pCMV6-Entry
Sequence Data
>RC202046 representing NM_012063
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCTAATTCCTGTCATAAACAAGCTCCAGGACGTCTTCAACACGGTGGGCGCCGACATCATCC
AGCTGCCTCAAATCGTCGTAGTGGGAACGCAGAGCAGCGGAAAGAGCTCAGTGCTAGAAAGCCTGGTGGG
GAGGGACCTGCTTCCCAGAGGTACTGGAATTGTCACCCGGAGACCTCTCATTCTGCAACTGGTCCATGTT
TCACAAGAAGATAAACGGAAAACAACAGGAGAAGAAAATGGGGTGGAAGCAGAAGAATGGGGTAAATTTC
TTCACACCAAAAATAAGCTTTACACGGATTTTGATGAAATTCGACAAGAAATTGAAAATGAAACAGAAAG
AATTTCAGGAAATAATAAGGGAGTAAGCCCTGAACCAATTCATCTTAAGATTTTTTCACCCAACGTTGTC
AATTTGACACTTGTGGATTTGCCAGGAATGACCAAGGTGCCTGTAGGTGATCAACCTAAGGATATTGAGC
TTCAAATCAGAGAGCTCATTCTTCGGTTCATCAGTAATCCTAATTCCATTATCCTCGCTGTCACTGCTGC
TAATACAGATATGGCAACATCAGAGGCACTTAAAATTTCAAGAGAGGTAGATCCAGATGGTCGCAGAACC
CTAGCTGTAATCACTAAACTTGATCTCATGGATGCGGGTACTGATGCCATGGATGTATTGATGGGAAGGG
TTATTCCAGTCAAACTTGGAATAATTGGAGTAGTTAACAGGAGCCAGCTAGATATTAACAACAAGAAGAG
TGTAACTGATTCAATCCGTGATGAGTATGCTTTTCTTCAAAAGAAATATCCATCTCTGGCCAATAGAAAT
GGAACAAAGTATCTTGCTAGGACTCTAAACAGGTTACTGATGCATCACATCAGAGATTGTTTACCAGAGT
TGAAAACAAGAATAAATGTTCTAGCTGCTCAGTATCAGTCTCTTCTAAATAGCTACGGTGAACCCGTGGA
TGATAAAAGTGCTACTTTACTCCAACTTATTACCAAATTTGCCACAGAATATTGTAACACTATTGAAGGA
ACTGCAAAATATATTGAAACTTCGGAGCTATGCGGTGGTGCTAGAATTTGTTATATTTTCCATGAGACTT
TTGGGCGAACCTTAGAATCTGTTGATCCACTTGGTGGCCTTAACACTATTGACATTTTGACTGCCATTAG
AAATGCTACTGGTCCTCGTCCTGCTTTATTTGTGCCTGAGGTTTCATTTGAGTTACTGGTGAAGCGGCAA
ATCAAACGTCTAGAAGAGCCCAGCCTCCGCTGTGTGGAACTGGTTCATGAGGAAATGCAAAGGATCATTC
AGCACTGTAGCAATTACAGTACACAGGAATTGTTACGATTTCCTAAACTTCATGATGCCATAGTTGAAGT
GGTGACTTGTCTTCTTCGTAAAAGGTTGCCTGTTACAAATGAAATGGTCCATAACTTAGTGGCAATTGAA
CTGGCTTATATCAACACAAAACATCCAGACTTTGCTGATGCTTGTGGGCTAATGAACAATAATATAGAGG
AACAAAGGAGAAACAGGCTAGCCAGAGAATTACCTTCAGCTGTATCACGAGACAAGTTAATTCAGGACAG
CAGAAGAGAAACTAAAAATGTTGCATCTGGAGGTGGTGGGGTTGGAGATGGTGTTCAAGAACCAACCACA
GGCAACTGGAGAGGAATGCTGAAAACTTCAAAAGCTGAAGAGTTATTAGCAGAAGAAAAATCAAAACCCA
TTCCAATTATGCCAGCCAGTCCACAAAAAGGTCATGCCGTGAACCTGCTAGATGTGCCAGTTCCTGTTGC
ACGAAAACTATCTGCTCGGGAACAGCGAGATTGTGAGGTTATTGAACGACTCATTAAATCATATTTTCTC
ATTGTCAGAAAGAATATTCAAGACAGTGTGCCAAAGGCAGTAATGCATTTTTTGGTTAATCATGTGAAAG
ACACTCTTCAGAGTGAGCTAGTAGGCCAGCTGTATAAATCATCCTTATTGGATGATCTTCTGACAGAATC
TGAGGACATGGCACAGCGCAGGAAAGAAGCAGCTGATATGCTAAAGGCATTACAAGGAGCCAGTCAAATT
ATTGCTGAAATCCGGGAGACTCATCTTTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202046 representing NM_012063
Red=Cloning site Green=Tags(s)

MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHV
SQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVV
NLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRT
LAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRN
GTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEG
TAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIE
LAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKLIQDSRRETKNVASGGGGVGDGVQEPTT
GNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFL
IVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQI
IAEIRETHLW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012063
ORF Size 2130 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012063.1, NM_012063.2, NM_012063.3, NP_036193
RefSeq Size 2415
RefSeq ORF 2133
Locus ID 10059
Cytogenetics 12p11.21
Domains dynamin_2, dynamin, GED
Protein Pathways Endocytosis, Fc gamma R-mediated phagocytosis
MW 79.3 kDa
Gene Summary This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated in several neurological disorders, including Alzheimer's disease. Mutations in this gene are associated with the autosomal dominant disorder, encephalopathy, lethal, due to defective mitochondrial and peroxisomal fission (EMPF). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)