Transmembrane Protein 175 (TMEM175) (NM_032326) Human Tagged ORF Clone

CAT#: RC201422

Reviews ()
Write a review

TMEM175 (Myc-DDK-tagged)-Human transmembrane protein 175 (TMEM175)



  "NM_032326" in other vectors (4)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TMEM175
Synonyms hTMEM175
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201422 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCAGCCCCGGACCCCAGAGCAGGCACTGGATACACCGGGGGACTGCCCCCCAGGCAGGAGAGACG
AGGACGCTGGGGAGGGGATCCAGTGCTCCCAACGCATGCTCAGCTTCAGTGACGCCCTGCTGTCCATCAT
CGCCACCGTCATGATCCTGCCTGTGACCCACACGGAGATCTCCCCAGAACAGCAGTTCGACAGAAGTGTA
CAGAGGCTTCTGGCAACACGGATTGCCGTCTACCTGATGACCTTTCTCATCGTGACAGTGGCCTGGGCAG
CACACACAAGGTTGTTCCAAGTTGTTGGGAAAACAGACGACACACTTGCCCTGCTCAACCTGGCCTGCAT
GATGACCATCACCTTCCTGCCTTACACGTTTTCGTTAATGGTGACCTTCCCTGATGTGCCTCTGGGCATC
TTCTTGTTCTGTGTGTGTGTGATCGCCATCGGGGTCGTGCAGGCACTGATTGTGGGGTACGCATTCCACT
TCCCGCACCTGCTGAGCCCGCAGATCCAGCGCTCTGCCCACAGGGCTCTGTACCGACGACACGTCCTGGG
CATCGTCCTCCAAGGCCCGGCCCTGTGCTTTGCAGCGGCCATCTTCTCTCTCTTCTTTGTCCCCTTGTCT
TACCTGCTGATGGTGACTGTCATCCTCCTCCCCTATGTCAGCAAGGTCACCGGCTGGTGCAGAGACAGGC
TCCTGGGCCACAGGGAGCCCTCGGCTCACCCAGTGGAAGTCTTCTCGTTTGACCTCCACGAGCCACTCAG
CAAGGAGCGCGTGGAAGCCTTCAGCGACGGAGTCTACGCCATCGTGGCCACGCTTCTCATCCTGGACATC
TGCGAAGACAACGTCCCGGACCCCAAGGATGTGAAGGAGAGGTTCAGCGGCAGCCTCGTGGCCGCCCTGA
GTGCGACCGGGCCGCGCTTCCTGGCGTACTTCGGCTCCTTCGCCACAGTGGGACTGCTGTGGTTCGCCCA
CCACTCACTCTTCCTGCATGTGCGCAAGGCCACGCGGGCCATGGGGCTGCTGAACACGCTCTCGCTGGCC
TTCGTGGGTGGCCTCCCACTAGCCTACCAGCAGACCTCGGCCTTCGCCCGGCAGCCCCGCGATGAGCTGG
AGCGCGTGCGTGTCAGCTGCACCATCATCTTCCTGGCCAGCATCTTCCAGCTGGCCATGTGGACCACGGC
GCTGCTGCACCAGGCGGAGACGCTGCAGCCCTCGGTGTGGTTTGGCGGCCGGGAGCATGTGCTCATGTTC
GCCAAGCTGGCGCTGTACCCCTGTGCCAGCCTGCTGGCCTTCGCCTCCACCTGCCTGCTGAGCAGGTTCA
GTGTGGGCATCTTCCACCTCATGCAGATCGCCGTGCCCTGCGCCTTCCTGTTGCTGCGCCTGCTCGTGGG
CCTGGCCCTGGCCACCCTGCGGGTCCTGCGGGGCCTCGCCCGGCCCGAACACCCCCCGCCAGCCCCCACG
GGCCAGGACGACCCACAGTCCCAGCTCCTCCCTGCCCCCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201422 protein sequence
Red=Cloning site Green=Tags(s)

MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSV
QRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGI
FLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLS
YLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDI
CEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLA
FVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF
AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPT
GQDDPQSQLLPAPC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032326
ORF Size 1512 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032326.2, NP_115702.1
RefSeq Size 1884 bp
RefSeq ORF 1515 bp
Locus ID 84286
UniProt ID Q9BSA9
Cytogenetics 4p16.3
Protein Families Transmembrane
MW 55.6 kDa
Gene Summary Organelle-specific potassium channel specifically responsible for potassium conductance in endosomes and lysosomes. Forms a potassium-permeable leak-like channel, which regulates lumenal pH stability and is required for autophagosome-lysosome fusion. Constitutes the major lysosomal potassium channel.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "TMEM175"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-MGC4618 Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.