MCPIP1 (ZC3H12A) (NM_025079) Human Tagged ORF Clone

CAT#: RC201381

Reviews ()
Write a review

ZC3H12A (Myc-DDK-tagged)-Human zinc finger CCCH-type containing 12A (ZC3H12A)



Reconstitution Protocol

USD 558.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ZC3H12A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZC3H12A
Synonyms dJ423B22.1; MCPIP; MCPIP-1; MCPIP1; Reg1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201381 representing NM_025079
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGGCCCCTGTGGAGAGAAGCCTGTCCTGGAAGCCAGCCCCACCATGAGTCTGTGGGAATTTGAGG
ACAGCCACAGCCGTCAGGGCACCCCAAGGCCGGGTCAAGAGCTGGCCGCTGAGGAGGCCTCGGCCCTGGA
ACTGCAGATGAAGGTGGACTTCTTCCGGAAGCTGGGCTATTCATCCACGGAGATCCACAGCGTCCTGCAG
AAGCTGGGCGTCCAGGCAGACACCAACACGGTGCTGGGTGAGCTGGTGAAACACGGGACAGCCACCGAGC
GGGAGCGCCAGACCTCACCGGACCCCTGCCCTCAGCTCCCTCTAGTCCCGCGGGGTGGTGGCACCCCTAA
GGCTCCCAACCTGGAGCCTCCACTCCCAGAAGAGGAAAAGGAGGGCAGCGACCTGAGACCAGTGGTCATC
GATGGGAGCAACGTGGCCATGAGCCATGGGAACAAGGAGGTCTTCTCCTGCCGGGGCATCCTGCTGGCAG
TGAACTGGTTTCTGGAGCGGGGCCACACAGACATCACAGTGTTTGTGCCATCCTGGAGGAAGGAGCAGCC
TCGGCCCGACGTGCCCATCACAGACCAGCACATCCTGCGGGAACTGGAGAAGAAGAAGATCCTGGTGTTC
ACACCATCACGACGCGTGGGTGGCAAGCGGGTGGTGTGCTATGACGACAGATTCATTGTGAAGCTGGCCT
ACGAGTCTGACGGGATCGTGGTTTCCAACGACACATACCGTGACCTCCAAGGCGAGCGGCAGGAGTGGAA
GCGCTTCATCGAGGAGCGGCTGCTCATGTACTCCTTCGTCAATGACAAGTTTATGCCCCCTGATGACCCA
CTGGGCCGGCACGGGCCCAGCCTGGACAACTTCCTGCGTAAGAAGCCACTCACTTTGGAGCACAGGAAGC
AGCCGTGTCCCTATGGAAGGAAATGCACCTATGGGATCAAGTGCCGATTCTTCCACCCAGAGCGGCCAAG
CTGCCCCCAGCGCTCTGTGGCAGATGAGCTCCGTGCCAATGCTCTCCTCTCACCCCCCAGAGCCCCAAGC
AAGGACAAAAATGGCCGGCGGCCTTCACCTTCATCCCAGTCCAGCTCTCTGCTAACAGAGAGTGAGCAGT
GCAGCCTGGATGGGAAGAAGCTGGGGGCCCAGGCATCCCCAGGGTCCCGCCAAGAGGGTCTAACACAGAC
CTATGCCCCATCAGGCAGGAGCCTCGCACCTAGCGGGGGCAGTGGCAGCAGCTTTGGGCCCACAGACTGG
CTCCCACAGACGCTGGACTCACTCCCGTACGTCTCCCAGGATTGCCTGGACTCGGGCATTGGCTCCCTGG
AGAGCCAGATGTCGGAACTTTGGGGGGTTCGAGGAGGAGGCCCTGGTGAGCCGGGCCCACCCCGAGCCCC
TTACACGGGCTACAGTCCCTATGGATCTGAGCTCCCAGCCACCGCAGCCTTCTCTGCCTTTGGCCGGGCC
ATGGGTGCTGGCCACTTCAGTGTCCCTGCCGACTACCCACCCGCGCCCCCTGCCTTTCCACCTCGAGAGT
ACTGGTCTGAACCATACCCACTGCCCCCACCCACATCAGTCCTTCAGGAGCCCCCAGTGCAGAGCCCAGG
GGCTGGCAGGAGCCCGTGGGGCAGGGCAGACAGCCTGGCCAAGGAGCAGGCCAGCGTGTATACTAAGCTG
TGTGGTGTGTTTCCCCCGCACCTGGTGGAGGCTGTGATGGGGCGCTTCCCACAGCTCCTGGACCCCCAGC
AGCTGGCTGCCGAGATCCTCTCCTACAAGTCCCAGCACCCCAGTGAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC201381 representing NM_025079
Red=Cloning site Green=Tags(s)

MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQ
KLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVI
DGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVF
TPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDP
LGRHGPSLDNFLRKKPLTLEHRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPS
KDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRA
MGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRADSLAKEQASVYTKL
CGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025079
ORF Size 1797 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025079.1, NP_079355.1
RefSeq Size 2697 bp
RefSeq ORF 1800 bp
Locus ID 80149
UniProt ID Q5D1E8
Cytogenetics 1p34.3
MW 65.5 kDa
Gene Summary ZC3H12A is an MCP1 (CCL2; MIM 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[supplied by OMIM, Mar 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.