BAT3(BAG6) (NM_080702) Human Tagged ORF Clone

CAT#: RC201122

BAG6 (Myc-DDK-tagged)-Human BCL2-associated athanogene 6 (BAG6), transcript variant 2

Clone Modification / Custom Cloning Service

USD 98.00

USD 800.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BAT3(BAG6) (NM_080702) Human Tagged ORF Clone
Symbol BAG6
Synonyms BAG-6; BAT3; D6S52E; G3
Vector pCMV6-Entry
Sequence Data
>RC201122 representing NM_080702
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCTAATGATAGTACCAGTACCGCTGTGGAGGAGCCTGACAGCTTGGAGGTGTTGGTGAAGACCT
TGGACTCTCAAACTCGTACCTTTATTGTGGGGGCCCAGATGAATGTAAAAGAGTTTAAGGAGCACATTGC
TGCCTCTGTCAGCATCCCATCTGAAAAACAACGGCTCATTTACCAGGGACGAGTTCTGCAAGATGATAAG
AAGCTTCAGGAATACAATGTTGGGGGAAAGGTTATCCACCTGGTGGAACGGGCTCCTCCTCAGACTCACC
TCCCTTCTGGGGCATCTTCTGGGACGGGGTCTGCCTCAGCCACTCATGGTGGGGGATCCCCCCCTGGTAC
TCGGGGGCCTGGGGCCTCTGTTCATGACCGGAATGCCAACAGCTATGTCATGGTTGGAACCTTCAATCTT
CCTAGTGACGGCTCTGCTGTGGATGTTCACATCAACATGGAACAGGCCCCGATTCAGAGTGAGCCCCGGG
TACGGCTGGTGATGGCTCAGCACATGATCAGGGATATACAGACCTTACTATCCCGGATGGAGTGTCGAGG
AGGGCCCCAACCGCAGCACAGTCAGCCGCCCCCGCAGCCACCGGCTGTGACCCCGGAGCCAGTAGCCTTG
AGCTCTCAAACATCAGAACCAGTTGAAAGTGAAGCACCTCCCCGGGAGCCCATGGAGGCAGAAGAAGTGG
AGGAGCGTGCCCCAGCCCAGAACCCGGAGCTCACTCCTGGCCCAGCCCCAGCGGGCCCAACACCTGCCCC
GGAAACAAATGCACCCAACCATCCTTCCCCTGCGGAGTATGTCGAGGTGCTCCAGGAGCTACAGCGGCTG
GAGAGTCGCCTCCAGCCCTTCTTGCAGCGCTACTACGAGGTTCTGGGTGCTGCTGCCACCACGGACTACA
ATAACAATCACGAGGGCCGGGAGGAGGATCAGCGGTTGATCAACTTGGTAGGGGAGAGCCTGCGACTGCT
GGGCAACACCTTTGTTGCACTGTCTGACCTGCGCTGCAATCTGGCCTGCACGCCCCCACGACACCTGCAT
GTGGTCCGGCCTATGTCTCACTACACCACCCCCATGGTGCTCCAGCAGGCAGCCATTCCCATACAGATCA
ATGTGGGAACCACTGTGACCATGACAGGAAATGGGACTCGGCCCCCCCCAACTCCCAATGCAGAGGCACC
TCCCCCTGGTCCTGGGCAGGCCTCATCCGTGGCTCCGTCTTCTACCAATGTCGAGTCCTCAGCTGAGGGG
GCTCCCCCGCCAGGTCCAGCTCCCCCGCCAGCCACCAGCCACCCGAGGGTCATCCGGATTTCCCACCAGA
GTGTGGAACCCGTGGTCATGATGCACATGAACATTCAAGATTCTGGCACACAGCCTGGTGGTGTTCCGAG
TGCTCCCACTGGCCCCCTGGGACCCCCTGGTCATGGCCAAACCCTGGGACAGCAGGTGCCAGGCTTCCCA
ACAGCTCCAACCCGGGTGGTGATTGCCCGGCCCACTCCTCCACAGGCTCGGCCTTCCCATCCTGGAGGGC
CCCCAGTCTCTGGGACACTGCAGGGCGCCGGTCTGGGTACCAATGCCTCGTTGGCCCAGATGGTGAGCGG
CCTTGTGGGGCAGCTTCTTATGCAGCCAGTCCTTGTGGCTCAGGGGACCCCAGGTATGGCTCCACCGCCA
GCCCCTGCCACTGCTTCTGCCAGTGCTGGCACCACCAACACAGCTACCACAGCTGGCCCCGCTCCTGGGG
GGCCTGCCCAGCCTCCACCCACCCCTCAACCCTCCATGGCTGATCTTCAGTTCTCTCAGCTTCTGGGGAA
CCTGCTAGGGCCTGCAGGGCCAGGGGCTGGAGGGCCTGGTGTGGCTTCTCCCACCATCACTGTGGCGATG
CCTGGTGTCCCTGCCTTTCTCCAAGGCATGACTGACTTCTTGCAGGCAACACAGACAGCCCCTCCACCAC
CCCCACCTCCTCCACCCCCACCACCTGCCCCAGAGCAGCAGACCATGCCCCCACCAGGCTCCCCTTCTGG
TGGCGCAGGGAGTCCTGGAGGCCTGGGTCTTGAGAGCCTGTCACCGGAGTTTTTTACCTCAGTGGTGCAG
GGTGTGCTCAGCTCCCTGCTGGGCTCCCTGGGGGCTCGGGCTGGCAGCAGTGAAAGTATTGCTGCCTTCA
TACAACGCCTCAGTGGATCCAGCAACATCTTTGAGCCTGGAGCTGATGGGGCCCTTGGATTCTTTGGGGC
CTTGCTTTCTCTTCTGTGCCAGAACTTCTCTATGGTGGACGTAGTGATGCTTCTCCATGGGCATTTCCAG
CCACTACAACGGCTCCAGCCCCAGCTGCGATCCTTCTTCCACCAGCACTACCTGGGTGGTCAGGAGCCCA
CACCCAGTAACATCCGGATGGCAACCCACACATTGATCACGGGGCTAGAAGAGTATGTGCGGGAGAGTTT
TTCCTTGGTGCAGGTTCAGCCAGGTGTGGACATCATCCGGACAAACCTGGAATTTCTCCAAGAGCAGTTT
AATAGCATTGCTGCGCATGTGCTGCATTGCACAGATAGTGGATTTGGGGCCCGGTTGCTGGAGTTGTGTA
ACCAAGGCCTGTTTGAATGCCTGGCCCTAAACCTGCACTGCTTGGGGGGACAGCAGATGGAGCTTGCTGC
TGTTATCAATGGCCGAATTCGTCGTATGTCTCGTGGGGTGAATCCCTCCTTGGTGAGCTGGCTGACCACT
ATGATGGGACTGAGGCTTCAGGTGGTACTGGAGCACATGCCTGTAGGCCCTGATGCCATTCTCAGATACG
TTCGCAGGGTTGGTGATCCCCCCCAGCCACTTCCTGAGGAGCCAATGGAAGTTCAGGGAGCAGAAAGAGC
TTCCCCTGAGCCTCAGCGGGAGAATGCTTCCCCAGCCCCTGGAACAACAGCAGAAGAGGCCATGTCCCGA
GGTCCACCTCCTGCTCCTGAGGGGGGCTCCCGGGATGAACAGGATGGAGCTTCAGCTGAGACAGAACCTT
GGGCAGCTGCAGTCCCCCCAGAATGGGTCCCTATTATCCAGCAGGACATTCAGAGCCAGCGGAAGGTGAA
ACCGCAGCCCCCTCTGAGTGATGCCTACCTCAGTGGTATGCCTGCCAAGAGACGCAAGACGATGCAGGGT
GAGGGCCCCCAGCTGCTTCTCTCAGAGGCTGTGAGCCGGGCAGCTAAGGCAGCCGGAGCTCGGCCCCTGA
CGAGCCCCGAGAGCCTGAGCCGGGACCTGGAGGCACCAGAGGTTCAGGAGAGCTACAGGCAGCAGCTCCG
GTCTGATATACAAAAACGACTGCAGGAAGACCCCAACTACAGTCCCCAGCGCTTCCCCAATGCCCAGCGG
GCCTTTGCTGATGATCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201122 representing NM_080702
Red=Cloning site Green=Tags(s)

MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDK
KLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNL
PSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMECRGGPQPQHSQPPPQPPAVTPEPVAL
SSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRL
ESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLH
VVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSAEG
APPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQQVPGFP
TAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPP
APATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGPGVASPTITVAM
PGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQ
GVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQ
PLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQF
NSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTT
MMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSR
GPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQG
EGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQR
AFADDP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_080702
ORF Size 3378 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_080702.1, NM_080702.2, NP_542433
RefSeq Size 3754
RefSeq ORF 3381
Locus ID 7917
Cytogenetics 6p21.33
Domains ubiquitin
Protein Families Stem cell - Pluripotency, Druggable Genome
MW 118.5 kDa
Gene Summary This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)