Calumenin(CALU) (NM_001219) Human Tagged ORF Clone

CAT#: RC200589

CALU (Myc-DDK-tagged)-Human calumenin (CALU), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Calumenin(CALU) (NM_001219) Human Tagged ORF Clone
Symbol CALU
Synonyms FLJ90608
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200589 representing NM_001219
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAA
AGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTA
TGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAG
GAAAGGCTTGGAAAGATTGTAAGTAAAATAGATGGCGACAAGGACGGGTTTGTCACTGTGGATGAGCTCA
AAGACTGGATTAAATTTGCACAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAGTGGAAGGGGCATGA
CCTCAATGAGGACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGCTACGTTTTAGATGAT
CCAGATCCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAG
ACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTA
CATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTA
GAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGC
GAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTG
GATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAAC
AAGGATGGCAAGCTTACCAAGGAGGAGATCGTTGACAAGTATGACTTATTTGTTGGCAGCCAGGCCACAG
ATTTTGGGGAGGCCTTAGTACGGCATGATGAGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200589 representing NM_001219
Red=Cloning site Green=Tags(s)

MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK
ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD
PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL
EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN
KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001219
ORF Size 945 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001219.1, NM_001219.2, NM_001219.3, NM_001219.4, NP_001210
RefSeq Size 3320
RefSeq ORF 948
Locus ID 813
Cytogenetics 7q32.1
Domains EFh
Protein Families Secreted Protein
MW 37.11 kDa
Gene Summary The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)