Glucose Transporter 5 GLUT5 (SLC2A5) (NM_003039) Human Tagged ORF Clone

CAT#: RC200418

Reviews ()
Write a review

SLC2A5 (Myc-DDK-tagged)-Human solute carrier family 2 (facilitated glucose/fructose transporter), member 5 (SLC2A5), transcript variant 1



  "NM_003039" in other vectors (6)

Reconstitution Protocol

USD 466.00

USD 699.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "SLC2A5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC2A5
Synonyms GLUT-5; GLUT5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200418 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCAACAGGATCAGAGCATGAAGGAAGGGAGGCTGACGCTTGTGCTTGCCCTGGCAACCCTGATAG
CTGCCTTTGGGTCATCCTTCCAGTATGGGTACAACGTGGCTGCTGTCAACTCCCCAGCACTGCTCATGCA
ACAATTTTACAATGAGACTTACTATGGTAGGACCGGTGAATTCATGGAAGACTTCCCCTTGACGTTGCTG
TGGTCTGTAACCGTGTCCATGTTTCCATTTGGAGGGTTTATCGGATCCCTCCTGGTCGGCCCCTTGGTGA
ATAAATTTGGCAGAAAAGGGGCCTTGCTGTTCAACAACATATTTTCTATCGTGCCTGCGATCTTAATGGG
ATGCAGCAGAGTCGCCACATCATTTGAGCTTATCATTATTTCCAGACTTTTGGTGGGAATATGTGCAGGT
GTATCTTCCAACGTGGTCCCCATGTACTTAGGGGAGCTGGCCCCTAAAAACCTGCGGGGGGCTCTCGGGG
TGGTGCCCCAGCTCTTCATCACTGTTGGCATCCTTGTGGCCCAGATCTTTGGTCTTCGGAATCTCCTTGC
AAACGTAGATGGCTGGCCGATCCTGCTGGGGCTGACCGGGGTCCCCGCGGCGCTGCAGCTCCTTCTGCTG
CCCTTCTTCCCCGAGAGCCCCAGGTACCTGCTGATTCAGAAGAAAGACGAAGCGGCCGCCAAGAAAGCCC
TACAGACGCTGCGCGGCTGGGACTCTGTGGACAGGGAGGTGGCCGAGATCCGGCAGGAGGATGAGGCAGA
GAAGGCCGCGGGCTTCATCTCCGTGCTGAAGCTGTTCCGGATGCGCTCGCTGCGCTGGCAGCTGCTGTCC
ATCATCGTCCTCATGGGCGGCCAGCAGCTGTCGGGCGTCAACGCTATCTACTACTACGCGGACCAGATCT
ACCTGAGCGCCGGCGTGCCGGAGGAGCACGTGCAGTACGTGACGGCCGGCACCGGGGCCGTGAACGTGGT
CATGACCTTCTGCGCCGTGTTCGTGGTGGAGCTCCTGGGTCGGAGGCTGCTGCTGCTGCTGGGCTTCTCC
ATCTGCCTCATAGCCTGCTGCGTGCTCACTGCAGCTCTGGCACTGCAGGACACAGTGTCCTGGATGCCAT
ACATCAGCATCGTCTGTGTCATCTCCTACGTCATAGGACATGCCCTCGGGCCCAGTCCCATACCCGCGCT
GCTCATCACTGAGATCTTCCTGCAGTCCTCTCGGCCATCTGCCTTCATGGTGGGGGGCAGTGTGCACTGG
CTCTCCAACTTCACCGTGGGCTTGATCTTCCCGTTCATCCAGGAGGGCCTCGGCCCGTACAGCTTCATTG
TCTTCGCCGTGATCTGCCTCCTCACCACCATCTACATCTTCTTGATTGTCCCGGAGACCAAGGCCAAGAC
GTTCATAGAGATCAACCAGATTTTCACCAAGATGAATAAGGTGTCTGAAGTGTACCCGGAAAAGGAGGAA
CTGAAAGAGCTTCCACCTGTCACTTCGGAACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200418 protein sequence
Red=Cloning site Green=Tags(s)

MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLL
WSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAG
VSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLL
PFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLS
IIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFS
ICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEE
LKELPPVTSEQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003039
ORF Size 1503 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003039.3
RefSeq Size 2454 bp
RefSeq ORF 1506 bp
Locus ID 6518
UniProt ID P22732
Cytogenetics 1p36.23
Domains sugar_tr
Protein Families Transmembrane
MW 55 kDa
Gene Summary The protein encoded by this gene is a fructose transporter responsible for fructose uptake by the small intestine. The encoded protein also is necessary for the increase in blood pressure due to high dietary fructose consumption. [provided by RefSeq, Jun 2016]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.