SND1 (NM_014390) Human Tagged ORF Clone

CAT#: RC200059

SND1 (Myc-DDK-tagged)-Human staphylococcal nuclease and tudor domain containing 1 (SND1)

Change vector?

USD 98

USD 560


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name SND1 (NM_014390) Human Tagged ORF Clone
Symbol SND1
Synonyms p100; TDRD11
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200059 representing NM_014390
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCTCCGCGCAGAGCGGCGGCTCCTCCGGGGGACCCGCGGTCCCCACCGTGCAGCGGGGCATCA
TCAAGATGGTCCTCTCAGGGTGCGCCATCATTGTCCGAGGTCAGCCTCGTGGTGGGCCTCCTCCTGAGCG
GCAGATCAACCTCAGCAACATTCGTGCTGGAAATCTTGCTCGCCGGGCAGCCGCCACACAACCTGATGCA
AAGGATACCCCTGATGAGCCCTGGGCATTTCCAGCTCGAGAGTTCCTTCGAAAGAAGCTGATTGGGAAGG
AAGTCTGTTTCACGATAGAAAACAAGACTCCCCAGGGGCGAGAGTATGGCATGATCTACCTTGGAAAAGA
TACCAATGGGGAAAACATTGCAGAATCACTGGTTGCAGAGGGCTTAGCCACCCGGAGAGAAGGCATGAGA
GCTAATAATCCTGAGCAGAACCGGCTTTCAGAATGTGAAGAACAAGCAAAGGCAGCCAAGAAAGGGATGT
GGAGTGAGGGGAACGGTTCACATACTATCCGGGATCTCAAGTATACCATTGAAAACCCAAGGCACTTTGT
GGACTCACACCACCAGAAGCCTGTTAATGCTATCATCGAGCATGTGCGGGACGGCAGTGTGGTCAGGGCC
CTGCTCCTCCCAGATTACTACCTGGTTACAGTCATGCTGTCAGGCATCAAGTGCCCAACTTTTCGACGGG
AAGCAGATGGCAGTGAAACTCCAGAGCCTTTTGCTGCAGAAGCCAAATTTTTCACTGAGTCGCGACTGCT
TCAGAGAGATGTTCAGATCATTCTGGAGAGCTGCCACAACCAGAACATTCTGGGTACCATCCTTCATCCA
AATGGCAACATCACAGAGCTCCTCCTGAAGGAAGGTTTCGCACGCTGTGTGGACTGGTCGATTGCAGTTT
ACACCCGGGGCGCAGAAAAGCTGAGGGCGGCAGAGAGGTTTGCCAAAGAGCGCAGGCTGAGAATATGGAG
AGACTATGTGGCTCCCACAGCTAATTTGGACCAAAAGGACAAGCAGTTTGTTGCCAAGGTGATGCAGGTT
CTGAATGCTGATGCCATTGTTGTGAAGCTGAACTCAGGCGATTACAAGACGATTCACCTGTCCAGCATCC
GACCACCGAGGCTGGAGGGGGAGAACACCCAGGATAAGAACAAGAAACTGCGTCCCCTGTATGACATTCC
TTACATGTTTGAGGCCCGGGAATTTCTTCGAAAAAAGCTTATTGGGAAGAAGGTCAATGTGACGGTGGAC
TACATTAGACCAGCCAGCCCAGCCACAGAGACAGTGCCTGCCTTTTCAGAGCGTACCTGTGCCACTGTCA
CCATTGGAGGAATAAACATTGCTGAGGCTCTTGTCAGCAAAGGTCTAGCCACAGTGATCAGATACCGGCA
GGATGATGACCAGAGATCATCACACTACGATGAACTGCTTGCTGCAGAGGCCAGAGCTATTAAGAATGGC
AAAGGATTGCATAGCAAGAAGGAAGTGCCTATCCACCGTGTTGCAGATATATCTGGGGATACCCAAAAAG
CAAAGCAGTTCCTGCCTTTTCTTCAGCGGGCAGGTCGTTCTGAAGCTGTGGTGGAATACGTCTTCAGTGG
TTCTCGTCTCAAACTCTATTTGCCAAAGGAAACTTGCCTTATCACCTTCTTGCTTGCAGGCATTGAATGC
CCCAGAGGAGCCCGAAACCTCCCAGGCTTGGTGCAGGAAGGAGAGCCCTTCAGCGAGGAAGCTACACTTT
TCACCAAGGAACTGGTGCTGCAGCGAGAGGTGGAGGTGGAGGTGGAGAGCATGGACAAGGCCGGCAACTT
TATCGGCTGGCTGCACATCGACGGTGCCAACCTGTCCGTCCTGCTGGTGGAGCACGCGCTCTCCAAGGTC
CACTTCACCGCCGAACGCAGCTCCTACTACAAGTCCCTGCTGTCTGCCGAGGAGGCCGCAAAGCAGAAGA
AAGAGAAGGTCTGGGCCCACTATGAGGAGCAGCCCGTGGAGGAGGTGATGCCAGTGCTGGAGGAGAAGGA
GCGATCTGCTAGCTACAAGCCCGTGTTTGTGACCGAGATCACTGATGACCTGCACTTCTACGTGCAGGAT
GTGGAGACCGGCACCCAGTTGGAGAAGCTGATGGAGAACATGCGCAATGACATTGCCAGTCACCCCCCTG
TAGAGGGCTCCTATGCCCCCCGCAGGGGAGAGTTCTGCATTGCCAAATTTGTAGATGGAGAATGGTACCG
TGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTACATTGACTACGGCAACAGAGAG
GTCCTGCCATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGCCA
CGGAGTATGCCTTCGCCTTCATCCAGGTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGT
AGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGAACACCTGAGTGCCGGCTGCCCCCATGTC
ACCCTGCAGTTTGCAGATTCCAAGGGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATGGTGG
AGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCCAAGAGTCAGCCAAGAG
CGCCAGGCTGAACCTGTGGCGCTATGGAGACTTTCGAGCTGATGATGCAGACGAATTTGGCTACAGCCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200059 representing NM_014390
Red=Cloning site Green=Tags(s)

MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDA
KDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMR
ANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRA
LLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHP
NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQV
LNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNG
KGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIEC
PRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKV
HFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQD
VETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNRE
VLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDADEFGYSR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014390
ORF Size 2730 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014390.2, NM_014390.3, NP_055205
RefSeq Size 3522
RefSeq ORF 2733
Locus ID 27044
Cytogenetics 7q32.1
Domains TUDOR, SNase, TUDOR
Protein Families Transcription Factors, Druggable Genome
MW 101.8 kDa
Gene Summary This gene encodes a transcriptional co-activator that interacts with the acidic domain of Epstein-Barr virus nuclear antigen 2 (EBNA 2), a transcriptional activator that is required for B-lymphocyte transformation. Other transcription factors that interact with this protein are signal transducers and activators of transcription, STATs. This protein is also thought to be essential for normal cell growth. A similar protein in mammals and other organisms is a component of the RNA-induced silencing complex (RISC). [provided by RefSeq, Jul 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations