Atf4 (NM_009716) Mouse Tagged ORF Clone

CAT#: MR205957

Atf4 (Myc-DDK-tagged) - Mouse activating transcription factor 4 (Atf4)

Change vector?

  • TrueORF®

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Atf4 (NM_009716) Mouse Tagged ORF Clone
Symbol Atf4
Synonyms Atf-4; C/ATF; CREB2; TAXREB67
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR205957 representing NM_009716
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGAGATGAGCTTCCTGAACAGCGAAGTGTTGGCGGGGGACTTGATGTCCCCCTTCGACCAGTCGG
GTTTGGGGGCTGAAGAAAGCCTAGGTCTCTTAGATGACTATCTGGAGGTGGCCAAGCACTTGAAACCTCA
TGGGTTCTCCAGCGACAAGGCGGGCTCCTCGGAATGGCCGGCTATGGATGATGGCTTGGCCAGTGCCTCA
GACACCGGCAAGGAGGATGCCTTTTCCGGGACAGATTGGATGTTGGAGAAAATGGATCTGAAAGAGTTTG
ACTTCGATGCTCTGTTTCGAATGGATGACCTGGAAACCATGCCAGATGAGCTCTTGACCACGTTGGATGA
CACATGTGATCTTTTTGCCCCTCTAGTCCAAGAGACTAATAAGGAGCCCCCTCAGACAGTGAACCCAATT
GGCCATCTCCCAGAAAGTTTAATAAAAGTCGACCAGGTTGCCCCCTTTACATTCTTGCAGCCTTTCCCCT
GTTCCCCAGGGGTTCTGTCTTCCACTCCAGAGCATTCCTTTAGTTTAGAGCTAGGCAGTGAAGTTGATAT
CTCTGAAGGAGACAGGAAGCCTGACTCTGCTGCTTACATTACTCTAATCCCTCCATGTGTAAAGGAGGAA
GACACTCCCTCTGACAATGACAGTGGCATCTGTATGAGCCCAGAGTCCTACCTGGGCTCTCCCCAGCATA
GCCCCTCCACCTCCAGGGCCCCACCAGACAATCTGCCTTCTCCAGGTGGTTCCCGTGGGTCTCCTCGGCC
CAAACCTTATGACCCACCTGGAGTTAGTTTGACAGCTAAAGTGAAGACTGAGAAATTGGATAAGAAGCTG
AAAAAGATGGAGCAAAACAAGACAGCAGCCACTAGGTACCGCCAGAAGAAGCGGGCTGAGCAGGAGGCCC
TCACTGGCGAGTGTAAGGAGCTAGAAAAAAAGAATGAGGCTCTGAAAGAGAAGGCAGATTCTCTGGCCAA
GGAGATCCAGTATCTGAAAGACCTGATAGAAGAGGTCCGTAAGGCAAGGGGGAAGAAGAGAGTTCCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR205957 representing NM_009716
Red=Cloning site Green=Tags(s)

MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASAS
DTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPI
GHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEE
DTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKL
KKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_009716
ORF Size 1047 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_009716.2, NM_009716.3, NP_033846
RefSeq Size 1749
RefSeq ORF 1050
Locus ID 11911
Cytogenetics 15 E1|15 37.85 cM
MW 38.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations