Epb41 (NM_001128606) Mouse Tagged ORF Clone

CAT#: MG225791

  • TrueORF®

Epb4.1 (GFP-tagged) - Mouse erythrocyte protein band 4.1 (Epb4.1) transcript variant 2, (10ug)

  View "NM_001128606" in other vectors (6)

USD 1,170.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Epb41 (NM_001128606) Mouse Tagged ORF Clone
Symbol Epb41
Synonyms 4.1R; AI415518; D4Ertd442e; Elp-1; Elp1; Epb4.1; mKIAA4056
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>MG225791 representing NM_001128606
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAACAGAGAAGAGTTTAGCGGCTGAAGCTGAGAATTCTCAGCACCAGCAACAGAAGGAAGAAGGAG
AGGGAGCCACAAACTCAGGCCAACAAGAAACTCAGCTGGAGGAGGCCTCCCAAGCGGCCGCAGCTGAGGG
CAGCGATCAGGGTGAGCAGAAGCTGAAAGCATCCAATGGGGACACTCCAACACATGAAGACTTGACCAAG
AACAAGGAACGGACATCAGAAAGCAGAGGCCTGTCACGACTGCTCTCCTCATTCCTCAAAAGGCCCAAGT
CGCAGGTCTCTGAAGAAGAAGGCAGAGAAGTAGAATCAGAGAAAGAGAAAGGTGAAGGGGGTCAGAAGGA
GATAGAACTTGGAAACAGCCTTGATGAAGACATCATTTTAAAGGCCCCCATTGCAGCTCCTGAACCTGAG
CTCAAAACAGACCCATCTTTGGATCTTCATTCATTAAGCAGTATAGAGACACAGCCAGCTCAGGAAGAAC
ACAGAGAGGACCCAGATTCTGAAACGAAGGAAGGAGAAGGGATTGAAGAGTGCTCTGGAACAGAGGTGAA
AGAGGACCCAGAGTCAAGAGCAGAGAGAGAACCCGAAGCCTCCCAGAAGCCCGTCAGAAGACACAGAAAC
ATGCACTGTAAGGTCTCCTTGTTGGATGACACGGTCTACGAATGTGTTGTAGAGAAACATGCTAAGGGAC
AAGACTTGCTGAAGCGAGTGTGCGAGCACCTCAACCTTTTGGAAGAAGACTACTTTGGTTTAGCCCTGTG
GGACAGCGCAACCTCTAAGACATGGCTGGATTCTGCCAAAGAAATAAAAAAGCAGGTTCGAGGTGTTCCT
TGGAATTTCACATTTAATGTGAAGTTTTATCCACCCGACCCAGCACAATTAACAGAAGACATAACAAGAT
ACTATTTATGTCTTCAGCTTCGGCAGGACATTGTTGCTGGACGTCTGCCCTGTTCCTTTGCAACTTTAGC
CCTACTCGGGTCTTACACGATCCAGTCTGAGCTGGGAGACTATGACCCAGAACTGCACGGCATGGATTAT
GTTAGTGATTTTAAACTGGCTCCAAATCAGACCAAGGAACTTGAAGAAAAGGTCATGGAATTGCATAAAT
CATACAGGTCCATGACTCCAGCTCAGGCTGACTTGGAATTTCTTGAGAATGCCAAAAAGTTGTCCATGTA
TGGAGTTGATCTTCACAAAGCAAAGGACTTGGAGGGAGTGGACATTATTCTCGGCGTCTGCTCCAGCGGC
CTTCTGGTTTACAAAGACAAGTTGAGAATTAACCGCTTTCCTTGGCCCAAAGTGCTAAAGATTTCTTACA
AACGCAGCAGCTTCTTCATCAAGATCCGGCCTGGAGAGCAAGAACATTATGAAAGTACCATCGGCTTCAA
GCTCCCCAGTTATCGAGCGGCCAAGAAACTATGGAAGGTCTGTGTGGAGCATCACACGTTCTTCAGACTC
ACCTCTACAGACACCATCCCCAAAAGCAAGTTTCTTGCCCTGGGATCCAAATTCCGATACAGTGGCCGGA
CTCAAGCTCAGACCAGGCAAGCCAGTGCCCTGATTGACAGGCCTGCTCCACACTTTGAGCGGACAGCAAG
CAAGCGGGCGTCCAGGAGCCTCGATGGAGCAGCAGCTGCTGAGTCCACAGACCGAAGTCCTCGGCCCACC
TCTGCCCCAGCCATTGCTCAGAGTCAGGTCACAGAAGGGCCAGGGGCACCTATCAAAAAAACACCAAAGG
AAGCTGTGAAGGTTGAAGAGAAGCGGGGAGAAGAGCCGGCTGAGCCCGCTGAGCCGGAGCCCACAGAAGC
ATGGAAGGATTTAGACAAGAGTCAAGAAGAGATCAAAAAGCACCATGCCAGCATCAGTGAACTGAAAAAG
AACTTTATGGAATCGGTACCCGAACCACGGCCCAGCGAGTGGGACAAGCGCTTATCTACACACTCACCCT
TCCGGACTCTTAACATCAACGGGCAAGTCCCTACTGGAGATGGACCTCCTCTGGTAAAGACTCAAACTGT
CACCATCTCAGATACTGCCAATGCTGTGAAAAGTGAAATCCCAACCAAAGATGTCCCTATTGTCCACACT
GAGACCAAGACCATCACCTATGAAGCTGCCCAGACTGAGGACAGCAATGGGGACTTAGACCCTGGAGTCT
TGCTGACAGCCCAGACCATCACATCCGAGACCACAAGTAGTACAACCACGACACAGATTACCAAGACTGT
AAAAGGTGGGATTTCTGAGACCCGGATCGAGAAGAGAATTGTGATCACAGGAGATGCCGATATCGACCAT
GATCAGGTCCTTGTACAAGCCATCAAGGAAGCCAAGGAGCAGCATCCAGACATGTCAGTGACCAAGGTGG
TCGTCCACCAGGAGACAGAGATCTCTGAGGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG225791 representing NM_001128606
Red=Cloning site Green=Tags(s)

MTTEKSLAAEAENSQHQQQKEEGEGATNSGQQETQLEEASQAAAAEGSDQGEQKLKASNGDTPTHEDLTK
NKERTSESRGLSRLLSSFLKRPKSQVSEEEGREVESEKEKGEGGQKEIELGNSLDEDIILKAPIAAPEPE
LKTDPSLDLHSLSSIETQPAQEEHREDPDSETKEGEGIEECSGTEVKEDPESRAEREPEASQKPVRRHRN
MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLALWDSATSKTWLDSAKEIKKQVRGVP
WNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGMDY
VSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSG
LLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEHYESTIGFKLPSYRAAKKLWKVCVEHHTFFRL
TSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAAESTDRSPRPT
SAPAIAQSQVTEGPGAPIKKTPKEAVKVEEKRGEEPAEPAEPEPTEAWKDLDKSQEEIKKHHASISELKK
NFMESVPEPRPSEWDKRLSTHSPFRTLNINGQVPTGDGPPLVKTQTVTISDTANAVKSEIPTKDVPIVHT
ETKTITYEAAQTEDSNGDLDPGVLLTAQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDH
DQVLVQAIKEAKEQHPDMSVTKVVVHQETEISEE

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001128606
ORF Size 2412 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001128606.1, NP_001122078
RefSeq Size 5141
RefSeq ORF 2415
Locus ID 269587
Cytogenetics 4 D2.3|4 64.54 cM

Other Versions

Other products for "Epb41"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones