March11 (NM_177597) Mouse Tagged ORF Clone

CAT#: MG220437

  • TrueORF®

41344 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 11 (March11), (10ug)

  View "NM_177597" in other vectors (6)

USD 460.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name March11 (NM_177597) Mouse Tagged ORF Clone
Symbol March11
Synonyms 9630025C22
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>MG220437 representing NM_177597
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGACGAGGGCAAAAAACGGTCTAGCCGGGCGGACAGCCTCGAAGCTGAGCCACCTCTGCCCCCGC
CGCCCCCACCCCCGCCTCCGGGAGAGTCGGTCCTGGTCCCCACCTCCCCACGCTACCGGCCGCCGCTGCC
CGCGCCTCTGGAGCGCATCGTAGGGTCGGGCGAGCCGCCGGTAGAACTGGCCCCTCGGCGCAAGGGCGCA
GGAGAGCCTCTACCGCCGCTGCCGCCGTCTCTGTTGCCCGGCGACCAGGAGGTGACAGCGGCGGGCGACT
CCTGCGAAGGTCCTAGGCGCCTTCCAGAGGTGAAGCTCCCCGAGGCTGCGACGGGGAAAGGCAGCCCGGG
GGAGCCCGAGGCCGGCGCGTGCCGGGAGGGCGAGCGGCGAGGCACCGGAGACCAGCCCGAAACACGCTCC
GTATGTAGCAGCCGCAGCAGCAGTAGTGGCGGCGGTAGCGACCAGCGCTCGGGGCACCAGCACCAGCACC
ATCAGCCCATTTGCAAGATCTGCTTCCAGGGCGCAGAGCAGGGTGAGTTGTTAAATCCTTGCCGATGTGA
TGGGTCTGTTCGATACACACATCAGCTGTGTCTTCTAAAGTGGATCAGTGAGAGAGGCTCCTGGACCTGC
GAGCTGTGCTGTTATAGATACCACGTCACAGCCATTAAAATGAAGCAACCTTGCCAGTGGCAGAGCATTT
CTATAACACTGGTTGAGAAAGTTCAGATGATCGCTGTAATCCTAGGATCCCTGTTCTTAATAGCGAGTGT
GACTTGGCTCCTCTGGTCAGCCTTCAGCCCCTATGCAGTGTGGCAGAGGAAGGACATCCTTTTTCAAATC
TGCTATGGAATGTATGGTTTTATGGATCTAGTGTGCATAGGCCTCATTGTGCATGAAGGAGCTGCCGTTT
ACAGAGTGTTTAAGCGATGGCGAGCTGTTAATTTGCACTGGGATGTGTTAAATTATGACAAAGCCACAGA
CATTGAAGAAAGCAGCCGAGGAGAGTCTTCCACAAGTAGGACTTTGTGGCTACCATTGTCAGCTCTGAGG
AACAGGAACTTGGTCCACCCAACGCAACTAACCTCACCACGGTTTCAGTGTGGCTATGTGCTATTACATC
TATTCAATCGGATGAGGGCCCATGAAGATGTATCGGAAGATAACGGCTCTGGGGAGGTAGTGATGAGAGT
GACGTCTGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG220437 representing NM_177597
Red=Cloning site Green=Tags(s)

MSDEGKKRSSRADSLEAEPPLPPPPPPPPPGESVLVPTSPRYRPPLPAPLERIVGSGEPPVELAPRRKGA
GEPLPPLPPSLLPGDQEVTAAGDSCEGPRRLPEVKLPEAATGKGSPGEPEAGACREGERRGTGDQPETRS
VCSSRSSSSGGGSDQRSGHQHQHHQPICKICFQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERGSWTC
ELCCYRYHVTAIKMKQPCQWQSISITLVEKVQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQI
CYGMYGFMDLVCIGLIVHEGAAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLSALR
NRNLVHPTQLTSPRFQCGYVLLHLFNRMRAHEDVSEDNGSGEVVMRVTSV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_177597
ORF Size 1200 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_177597.5, NP_808265
RefSeq Size 1547
RefSeq ORF 1203
Locus ID 211147
Cytogenetics 15|15 B1

Other Versions

Other products for "March11"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones