Golt1b (NM_025872) Mouse Tagged ORF Clone

CAT#: MG200864

Golt1b (GFP-tagged) - Mouse golgi transport 1 homolog B (S. cerevisiae) (Golt1b)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 443.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Golt1b (NM_025872) Mouse Tagged ORF Clone
Symbol Golt1b
Synonyms 2310061A22Rik; AA407874; AU024291; CGI-141
Vector pCMV6-AC-GFP
Sequence Data
>MG200864 representing NM_025872
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCTCCCTCACGGATACGCAGAAAATTGGCATGGGCTTAACAGGATTTGGAGTGTTTTTCCTGTTCT
TTGGAATGATTCTCTTTTTTGACAAAGCACTGCTGGCTATTGGAAATGTTCTGTTTGTGGCCGGCTTGGC
TTTTGTAATTGGTCTCGAGAGAACGTTCAGATTCTTCTTCCAGAGGCACAAGGTGAAGGCCACTGGGTTT
TTCCTGGGCGGTGTGTTCGTGGTCCTCATTGGTTGGCCTCTGATAGGCATGATCTTCGAAATTTATGGAT
TCTTTCTCTTGTTCAGGGGCTTTTTCCCAGTGGTCGTTGGCTTTATCAGAAGAGTACCTGTCCTCGGATC
CCTCCTAAATCTACCTGGAATCAGATCATTCGTAGACAAAGTTGGAGAAAGCAACAATATGGTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200864 representing NM_025872
Red=Cloning site Green=Tags(s)

MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQRHKVKATGF
FLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_025872
ORF Size 414 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_025872.4, NP_080148
RefSeq Size 2796
RefSeq ORF 417
Locus ID 66964
Cytogenetics 6|6 G2
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.