YES1 Rabbit Polyclonal Antibody

CAT#: TA358529

YES1 Antibody

Product Images

Rabbit Anti-YES1 antibody Catalog Number: ARP63762 Formalin Fixed Paraffin Embedded Tissue: Human Kidney Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Reactivities: Human
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA
• Specificity: Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
  Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Stability: Shelf life: one year from despatch.
• Predicted Protein Size: 61 kDa
• Gene Name: YES proto-oncogene 1, Src family tyrosine kinase
• Database Link:
  NP_005424
  Entrez Gene 7525 Human
  UniProt ID P07947
• Background: This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.
• Synonyms: c-yes; HsT441; OTTHUMP00000162194; p61-Yes; Yes

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Adherens junction, Tight junction