RSF1 Rabbit Polyclonal Antibody

CAT#: TA346784

Rabbit Polyclonal Anti-RSF1 Antibody

Product Images

WB Suggested Anti-RSF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RSF1 antibody: synthetic peptide directed towards the middle region of human RSF1. Synthetic peptide located within the following region: QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 164 kDa
• Gene Name: remodeling and spacing factor 1
• Database Link:
  NP_057662
  Entrez Gene 51773 Human
  UniProt ID Q96T23
• Background: This gene encodes a nuclear protein that interacts with hepatitis B virus X protein (HBX) and facilitates transcription of hepatitis B virus genes by the HBX transcription activator, suggesting a role for this interaction in the virus life cycle. This protein also interacts with SNF2H protein to form the RSF chromatin-remodeling complex, where the SNF2H subunit functions as the nucleosome-dependent ATPase, and this protein as the histone chaperone. [provided by RefSeq, Sep 2011]
• Synonyms: HBXAP; p325; RSF-1; XAP8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome