mtRNA polymerase (POLRMT) Rabbit Polyclonal Antibody

SKU TA346736

Rabbit Polyclonal Anti-POLRMT Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-POLRMT antibody is: synthetic peptide directed towards the C-terminal region of Human POLRMT. Synthetic peptide located within the following region: ALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 135 kDa
• Gene Name: polymerase (RNA) mitochondrial
• Database Link:
  NP_005026
  O00411
• Background: This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes. [provided by RefSeq, Jul 2008]
• Synonyms: APOLMT; h-mtRPOL; MTRNAP; MTRPOL
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Rat: 92%; Bovine: 85%; Yeast: 79%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors