HS3ST6 Rabbit Polyclonal Antibody

SKU TA346681

Rabbit Polyclonal Anti-HS3ST6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HS3ST6 antibody: synthetic peptide directed towards the C terminal of human HS3ST6. Synthetic peptide located within the following region: GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: heparan sulfate-glucosamine 3-sulfotransferase 6
• Database Link:
  NP_001009606
  Q96QI5
• Background: HS3ST6 is a single-pass type II membrane protein. It belongs to the sulfotransferase 1 family. It transfers a sulfuryl group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
• Synonyms: 3-OST-6; HS3ST5
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Horse: 86%; Zebrafish: 86%; Rabbit: 79%

Reference Data