GADD45B Rabbit Polyclonal Antibody

CAT#: TA346618

Rabbit Polyclonal Anti-GADD45B Antibody

Product Images

WB Suggested Anti-GADD45B Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  WB Suggested Anti-GADD45B Antibody Titration: 3 ug/ml; Positive Control: Human Fetal Lung

• 

  Product Page for GADD45B antibody - middle region; Sample Type: Human Prostate Cancer; Primary Antibody Dilution: 2 ug/mL; Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue); Gene Name: GADD45B;

• 

  Product Page for GADD45B antibody - middle region; Sample Type: Human Prostate Cancer; Primary Antibody Dilution: 2 ug/mL; Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue); Gene Name: GADD45B;

• 

  Product Page for GADD45B antibody - middle region; Sample Type: Human Prostate Cancer; Primary Antibody Dilution: 2 ug/mL; Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue); Gene Name: GADD45B;

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: growth arrest and DNA damage inducible beta
• Database Link:
  NP_056490
  Entrez Gene 17873 MouseEntrez Gene 4616 Human
  UniProt ID O75293
• Background: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008]
• Synonyms: GADD45BETA; MYD118
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, MAPK signaling pathway, p53 signaling pathway