GAS8 Rabbit Polyclonal Antibody

CAT#: TA346497

Rabbit Polyclonal Anti-GAS8 Antibody


 Product Datasheet for 'TA346497'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GAS8 antibody: synthetic peptide directed towards the N terminal of human GAS8. Synthetic peptide located within the following region: VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 56
Gene Name growth arrest specific 8
Background This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]
Synonyms CILD33; DRC4; GAS11
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Other products for "GAS8"
Frequently bought together (2)
Transient overexpression lysate of growth arrest-specific 8 (GAS8), transcript variant 1
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones