FAM107A Rabbit Polyclonal Antibody

SKU
TA346456
Rabbit Polyclonal Anti-FAM107A Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FAM107A antibody: synthetic peptide directed towards the middle region of human FAM107A. Synthetic peptide located within the following region: RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 17 kDa
Gene Name family with sequence similarity 107 member A
Database Link
Background When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.
Synonyms DRR1; TU3A
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 86%; Zebrafish: 83%
Reference Data
Write Your Own Review
You're reviewing:FAM107A Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.