SLC38A3 Rabbit Polyclonal Antibody

CAT#: TA346441

Rabbit Polyclonal Anti-SLC38A3 Antibody

Product Images

WB Suggested Anti-SLC38A3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate; SLC38A3 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Primary Antibody Dilution: 1: 200; Secondary Antibody: Goat anti-rabbit Alexafluor 568; Secondary Antibody: ilution: 1: 200; Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue; Gene Name: SLC38A3; Submitted by: Anonymous

• 

  Primary Antibody Dilution: 1: 200; Secondary Antibody: Goat anti-rabbit Alexafluor 568; Secondary Antibody: ilution: 1: 200; Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue; Gene Name: SLC38A3; Submitted by: Anonymous

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC38A3 antibody: synthetic peptide directed towards the N terminal of human SLC38A3. Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: solute carrier family 38 member 3
• Database Link:
  NP_006832
  Entrez Gene 76257 MouseEntrez Gene 10991 Human
  UniProt ID Q99624
• Background: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and£íay play a role in nitrogen metabolism and synaptic transmission.
• Synonyms: G17; NAT1; SN1; SNAT3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Sheep: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane