SLC38A3 Rabbit Polyclonal Antibody

SKU TA346441

Rabbit Polyclonal Anti-SLC38A3 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC38A3 antibody: synthetic peptide directed towards the N terminal of human SLC38A3. Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: solute carrier family 38 member 3
• Database Link:
  NP_006832
  Q99624
• Background: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and£íay play a role in nitrogen metabolism and synaptic transmission.
• Synonyms: G17; NAT1; SN1; SNAT3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Sheep: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane