SLC6A8 Rabbit Polyclonal Antibody

SKU TA346412

Rabbit Polyclonal Anti-SLC6A8 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC6A8 antibody: synthetic peptide directed towards the N terminal of human SLC6A8. Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: solute carrier family 6 member 8
• Database Link:
  NP_005620
  P48029
• Background: SLC6A8 is required for the uptake of creatine in muscles and brain.
• Synonyms: CCDS1; CRT; CRTR; CT1; CTR5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane