Factor XIII (F13B) Rabbit Polyclonal Antibody

CAT#: TA346313

Reviews ()
Write a review

Rabbit Polyclonal Anti-F13B Antibody



Get 29% off any Over-Expression Cell Lysate, a validated WB control, with any Ab purchase. Use code “OEL29“. View details.

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-F13B antibody: synthetic peptide directed towards the middle region of human F13B. Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 73 kDa
Gene Name coagulation factor XIII B chain
Background F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.This gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms FXIIIB
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Dog: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Complement and coagulation cascades
Other products for "F13B"
Frequently bought together (2)
Transient overexpression lysate of coagulation factor XIII, B polypeptide (F13B)
    • 100 ug

USD 550.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies