ABP1 (AOC1) Rabbit Polyclonal Antibody

CAT#: TA346273

Rabbit Polyclonal Anti-ABP1 Antibody

Product Images

WB Suggested Anti-ABP1 Antibody; Titration: 1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-ABP1 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: amine oxidase, copper containing 1
• Database Link:
  NP_001082
  Entrez Gene 26 Human
  UniProt ID P19801
• Background: ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.
• Synonyms: ABP; ABP1; DAO; DAO1; KAO
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 86%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Arginine and proline metabolism, Histidine metabolism, Tryptophan metabolism