MSH4 Rabbit Polyclonal Antibody

SKU TA346020

Rabbit Polyclonal Anti-MSH4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MSH4 antibody: synthetic peptide directed towards the N terminal of human MSH4. Synthetic peptide located within the following region: SSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 105 kDa
• Gene Name: mutS homolog 4
• Database Link:
  NP_002431
  O15457
• Background: MSH4 is involved in meiotic recombination. MSH4 is also required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis.
• Synonyms: mutS homolog 4; mutS homolog 4 (E. coli); OTTHUMP00000011349
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome