APOBEC2 Rabbit Polyclonal Antibody

CAT#: TA345985

Rabbit Polyclonal Anti-APOBEC2 Antibody

Product Images

WB Suggested Anti-APOBEC2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Muscle

• 

  Rabbit Anti-APOBEC2 Antibody; Paraffin Embedded Tissue: Human Skin; Cellular Data: Squamous epithelial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APOBEC2 antibody: synthetic peptide directed towards the N terminal of human APOBEC2. Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: apolipoprotein B mRNA editing enzyme catalytic subunit 2
• Database Link:
  NP_006780
  Entrez Gene 10930 Human
  UniProt ID Q9Y235
• Background: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
• Synonyms: ARCD1; ARP1
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 90%; Rat: 90%; Guinea pig: 90%; Mouse: 86%