APOBEC2 Rabbit Polyclonal Antibody

SKU TA345985

Rabbit Polyclonal Anti-APOBEC2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APOBEC2 antibody: synthetic peptide directed towards the N terminal of human APOBEC2. Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: apolipoprotein B mRNA editing enzyme catalytic subunit 2
• Database Link:
  NP_006780
  Q9Y235
• Background: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
• Synonyms: ARCD1; ARP1
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 90%; Rat: 90%; Guinea pig: 90%; Mouse: 86%

Reference Data