EIF4G1 Rabbit Polyclonal Antibody

CAT#: TA345902

Rabbit Polyclonal Anti-EIF4G1 Antibody

Product Images

WB Suggested Anti-EIF4G1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: HepG2 cell lysateEIF4G1 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF4G1 antibody: synthetic peptide directed towards the middle region of human EIF4G1. Synthetic peptide located within the following region: PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 175 kDa
• Gene Name: eukaryotic translation initiation factor 4 gamma 1
• Database Link:
  NP_886553
  Entrez Gene 1981 Human
  UniProt ID Q04637
• Background: EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome.The protein encoded by this gene is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome. Alternative splicing results in five transcript variants encoding four distinct isoforms.
• Synonyms: EIF-4G1; EIF4F; EIF4G; EIF4GI; P220; PARK18
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Pathways: Viral myocarditis