Germany
Japan
United Kingdom
China
Antibodies
View as table Download
EIF4G1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human eIF4G around the phosphorylation site of Serine 1232 (P-V-Sp-P-L). |
EIF4G1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human eIF4G around the phosphorylation site of Serine 1232 (P-V-Sp-P-L). |
EIF4G1 pSer1232 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eIF4G around the phosphorylation site of Serine 1232 (P-V-SP-P-L). |
EIF4G1 pSer1232 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eIF4G around the phosphorylation site of Serine 1232 (P-V-SP-P-L). |
EIF4G1 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G1 (NP_886553.3). |
| Modifications | Unmodified |
EIF4G1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 1080-1130 of Human eIF4G. |
EIF4G Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G (NP_886553.3). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-EIF4G1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4G1 antibody: synthetic peptide directed towards the middle region of human EIF4G1. Synthetic peptide located within the following region: PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ |
Phospho-EIF4G1-S1108 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S1108 of human EIF4G1 (NP_001181875.1). |
| Modifications | Phospho S1108 |
EIF4G1 (phospho-S1148) polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to residues in Human EIF4G1 around the phosphorylation site of S1148. |
Active filters
Target Symbol
- EIF4G1