HCC1 (RBM39) Rabbit Polyclonal Antibody

SKU TA345901

Rabbit Polyclonal Anti-RBM39 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM39 antibody: synthetic peptide directed towards the middle region of human RBM39. Synthetic peptide located within the following region: FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: RNA binding motif protein 39
• Database Link:
  NP_001229528
  Q14498
• Background: RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors.
• Synonyms: CAPER; CAPERalpha; FSAP59; HCC1; RNPC2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 91%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors