EMAP II (AIMP1) Rabbit Polyclonal Antibody

CAT#: TA345896

Rabbit Polyclonal Anti-SCYE1 Antibody

Product Images

WB Suggested Anti-SCYE1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate; AIMP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCYE1 antibody: synthetic peptide directed towards the N terminal of human SCYE1. Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: aminoacyl tRNA synthetase complex interacting multifunctional protein 1
• Database Link:
  NP_004748
  Entrez Gene 9255 Human
  UniProt ID Q12904
• Background: SCYE1 is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.The protein encoded by this gene is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.
• Synonyms: EMAP2; EMAPII; HLD3; p43; SCYE1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome