RRP9 Rabbit Polyclonal Antibody

CAT#: TA345895

Rabbit Polyclonal Anti-RRP9 Antibody

Product Images

WB Suggested Anti-RRP9 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate; RRP9 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RRP9 antibody: synthetic peptide directed towards the middle region of human RRP9. Synthetic peptide located within the following region: IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)
• Database Link:
  NP_004695
  Entrez Gene 9136 Human
  UniProt ID O43818
• Background: RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.
• Synonyms: RNU3IP2; U3-55K
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Rat: 86%; Dog: 79%; Mouse: 79%; Bovine: 79%; Guinea pig: 79%