EIF3S4 (EIF3G) Rabbit Polyclonal Antibody

CAT#: TA345853

Rabbit Polyclonal Anti-EIF3S4 Antibody

Product Images

WB Suggested Anti-EIF3S4 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-EIF3S4 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF3S4 antibody: synthetic peptide directed towards the N terminal of human EIF3S4. Synthetic peptide located within the following region: SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: eukaryotic translation initiation factor 3 subunit G
• Database Link:
  NP_003746
  Entrez Gene 8666 Human
  UniProt ID O75821
• Background: EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.
• Synonyms: eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 93%; Zebrafish: 79%