EIF3B Rabbit Polyclonal Antibody

CAT#: TA345851

Rabbit Polyclonal Anti-EIF3S9 Antibody

Product Images

WB Suggested Anti-EIF3S9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate; EIF3B is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9. Synthetic peptide located within the following region: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: eukaryotic translation initiation factor 3 subunit B
• Database Link:
  NP_003742
  Entrez Gene 8662 Human
  UniProt ID P55884
• Background: EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
• Synonyms: EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%