SNRPF Rabbit Polyclonal Antibody

CAT#: TA345828

Reviews ()
Write a review

Rabbit Polyclonal Anti-SNRPF Antibody

Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 310.00

5 Days

    • 100 ul

Product images


Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SNRPF antibody: synthetic peptide directed towards the N terminal of human SNRPF. Synthetic peptide located within the following region: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 9 kDa
Gene Name small nuclear ribonucleoprotein polypeptide F
Background SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.
Synonyms Sm-F; SMF; snRNP-F
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%; Yeast: 86%
Reference Data
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
Other products for "SNRPF"
Frequently bought together (3)
Recombinant protein of human small nuclear ribonucleoprotein polypeptide F (SNRPF)
    • 20 ug

USD 748.00

Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide F (SNRPF)
    • 100 ug

USD 325.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
Clone ID reveals the Source of Monoclonal Antibodies