SNRPA1 Rabbit Polyclonal Antibody

SKU TA345825

Rabbit Polyclonal Anti-SNRPA1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNRPA1 antibody: synthetic peptide directed towards the N terminal of human SNRPA1. Synthetic peptide located within the following region: VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: small nuclear ribonucleoprotein polypeptide A'
• Database Link:
  NP_003081
  P09661
• Background: SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.
• Synonyms: Lea1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome