NOVA2 Rabbit Polyclonal Antibody

SKU
TA345800
Rabbit Polyclonal Anti-NOVA2 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NOVA2 antibody: synthetic peptide directed towards the N terminal of human NOVA2. Synthetic peptide located within the following region: MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 54 kDa
Gene Name NOVA alternative splicing regulator 2
Database Link
Background NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.
Synonyms ANOVA; NOVA3
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Dog: 77%; Rat: 77%; Bovine: 77%; Guinea pig: 77%
Reference Data
Write Your Own Review
You're reviewing:NOVA2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.