Aconitase 1 (ACO1) Rabbit Polyclonal Antibody

CAT#: TA345794

Rabbit Polyclonal Anti-ACO1 Antibody

Product Images

WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human kidney

• 

  Lanes: 1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extract; Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 3000; Gene Name: ACO1;

• 

  Lanes: 1. 45ug capan1 cell lysate; 2. 45 ug HPAF cell lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-Rabbit HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: ACO1;

• 

  Lanes: Lane 1: 100ug HePG2 lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Goat anti rabbit-HRP; Secondary Antibody Dilution: 1: 8000; Gene Name: ACO1;

• 

  Rabbit Anti-ACO1 Antibody; Paraffin Embedded Tissue: Human Muscle; Cellular Data: Skeletal muscle cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Sample Type: Human Capan1 cells (Pancreatic cancer cell line) Primary Antibody Dilution: 1: 300; Secondary Antibody: Anti-rabbit-AlexaFluor-488; Secondary Antibody: ilution: 1: 200; Color/Signal Descriptions: ACO1: Green DAPI: Blue; Gene Name: ACO1;

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 98 kDa
• Gene Name: aconitase 1
• Database Link:
  NP_002188
  Entrez Gene 11428 MouseEntrez Gene 48 Human
  UniProt ID P21399
• Background: ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.
• Synonyms: ACONS; HEL60; IREB1; IREBP; IREBP1; IRP1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Horse: 92%; Guinea pig: 91%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways