Auh Rabbit Polyclonal Antibody

SKU TA345785

Rabbit Polyclonal Anti-Auh Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Auh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: AU RNA binding protein/enoyl-coenzyme A hydratase
• Database Link:
  NP_057918
  Q9JLZ3
• Background: Auh Catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA. Auh has very low enoyl-CoA hydratase activity. Was originally identified as RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs.
• Synonyms: AUH
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%

Reference Data