RED1 (ADARB1) Rabbit Polyclonal Antibody

CAT#: TA345762

Rabbit Polyclonal Anti-ADARB1 Antibody

Product Images

ADARB1 antibody - N-terminal region validated by WB using Mouse brains at 1: 1000.

• 

  WB Suggested Anti-ADARB1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADARB1 antibody: synthetic peptide directed towards the N terminal of human ADARB1. Synthetic peptide located within the following region: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: adenosine deaminase, RNA specific B1
• Database Link:
  NP_001103
  Entrez Gene 110532 MouseEntrez Gene 104 Human
  UniProt ID P78563
• Background: ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region.
• Synonyms: ADAR2; DRABA2; DRADA2; RED1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Zebrafish: 92%; Bovine: 83%

Reference Data

• Protein Families: Druggable Genome