EXOSC10 Rabbit Polyclonal Antibody

SKU TA345696

Rabbit Polyclonal Anti-EXOSC10 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C terminal of human EXOSC10. Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 97 kDa
• Gene Name: exosome component 10
• Database Link:
  NP_001001998
  Q01780
• Background: EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.
• Synonyms: p2; p3; p4; PM; PM-Scl; PMSCL; PMSCL2; RRP6; Rrp6p; Scl-100
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%

Reference Data

• Protein Pathways: RNA degradation