INSIG1 Rabbit Polyclonal Antibody

CAT#: TA345657

Rabbit Polyclonal Anti-INSIG1 Antibody

Product Images

WB Suggested Anti-INSIG1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Spleen

• 

  Lanes: Lane 1: 50 ug human putamen lysate; Lane 2: 50 ug rat cortex lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Mouse anti-rabbit HRP; Secondary Antibody Dilution: 1: 15000; Gene Name: INSIG1;

• 

  Immunohistochemistry with Liver tissue at an antibody concentration of 10 ug/ml using anti-INSIG1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: insulin induced gene 1
• Database Link:
  NP_938150
  Entrez Gene 64194 RatEntrez Gene 3638 Human
  UniProt ID O15503
• Background: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane prote
• Synonyms: CL-6; CL6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane