BCL6B Rabbit Polyclonal Antibody

SKU TA345618

Rabbit Polyclonal Anti-BCL6B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BCL6B antibody: synthetic peptide directed towards the middle region of human BCL6B. Synthetic peptide located within the following region: LQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: B-cell CLL/lymphoma 6B
• Database Link:
  NP_862827
  Q8N143
• Background: BCL6B acts as a sequence-specific transcriptional repressor in association with BCL6. BCL6B may function in a narrow stage or be related to some events in the early B-cell development.
• Synonyms: BAZF; ZBTB28; ZNF62
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Zebrafish: 86%

Reference Data