TFAP2E Rabbit Polyclonal Antibody

SKU TA345609

Rabbit Polyclonal Anti-TFAP2E Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFAP2E antibody: synthetic peptide directed towards the C terminal of human TFAP2E. Synthetic peptide located within the following region: FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: transcription factor AP-2 epsilon
• Database Link:
  NP_848643
  Q6VUC0
• Background: TFAP2E belongs to AP-2 family of transcription factors which play an important role in regulating gene expression during development and differentiation of multiple organs and tissues. It may play an important role in skin biology.
• Synonyms: AP2E
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%

Reference Data

• Protein Families: Transcription Factors