ZNF92 Rabbit Polyclonal Antibody

SKU
TA345559
Rabbit Polyclonal Anti-ZNF92 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF92 antibody: synthetic peptide directed towards the C terminal of human ZNF92. Synthetic peptide located within the following region: YKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKLQT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 60 kDa
Gene Name zinc finger protein 92
Database Link
Background ZNF92 is a candidate transcription factor
Synonyms HEL-203; HPF12; HTF12; TF12
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF92 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.